GenomeNet

Database: Pfam
Entry: Toxin_4
LinkDB: Toxin_4
Original site: Toxin_4 
#=GF ID   Toxin_4
#=GF AC   PF00706.15
#=GF DE   Anenome neurotoxin
#=GF PI   toxin_4; Toxin_4; Toxin_4_;
#=GF AU   Bateman A
#=GF SE   Pfam-B_589 (release 2.1)
#=GF GA   20.90 20.90;
#=GF TC   21.40 76.80;
#=GF NC   20.50 17.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Sea_anemone_neurotoxin
#=GF DR   INTERPRO; IPR000693;
#=GF DR   SCOP; 1atx; fa;
#=GF DR   HOMSTRAD; seatoxin;
#=GF SQ   9
#=GS NA281_NEMVE/41-83  AC B1NWR6.2
#=GS NA237_NEMVE/41-83  AC P0CH90.1
#=GS NA21_NEMVE/41-83   AC B1NWS4.2
#=GS NA245_NEMVE/41-83  AC B1NWR7.1
#=GS NA271_NEMVE/41-83  AC P0CH45.1
#=GS NA240_NEMVE/41-83  AC B1NWS8.1
#=GS NA217_NEMVE/41-83  AC B1NWS1.2
#=GS NA239_NEMVE/41-83  AC P0CH46.1
#=GS NA241_NEMVE/41-83  AC A7SCE5.2
NA281_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA237_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA21_NEMVE/41-83              PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA245_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA271_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA240_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA217_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA239_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
NA241_NEMVE/41-83             PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
#=GC seq_cons                 PCACDSDGPDIRSASLSGIVWMGSCPSGWKKCKSYYSIVADCC
//
DBGET integrated database retrieval system