GenomeNet

Database: Pfam
Entry: UL40
LinkDB: UL40
Original site: UL40 
#=GF ID   UL40
#=GF AC   PF10682.7
#=GF DE   Glycoprotein of human cytomegalovirus HHV-5
#=GF AU   Mistry J, Coggill P
#=GF SE   PRODOM_PD113623
#=GF GA   25.00 25.00;
#=GF TC   516.40 516.30;
#=GF NC   20.40 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10799855
#=GF RT   Cutting edge: the human cytomegalovirus UL40 gene product
#=GF RT   contains a ligand for HLA-E and prevents NK cell-mediated lysis. 
#=GF RA   Ulbrecht M, Martinozzi S, Grzeschik M, Hengel H, Ellwart JW, Pla
#=GF RA   M, Weiss EH; 
#=GF RL   J Immunol. 2000;164:5019-5022.
#=GF RN   [2]
#=GF RM   10669413
#=GF RT   Surface expression of HLA-E, an inhibitor of natural killer
#=GF RT   cells, enhanced by human cytomegalovirus gpUL40.
#=GF RA   Tomasec P, Braud VM, Rickards C, Powell MB, McSharry BP, Gadola
#=GF RA   S, Cerundolo V, Borysiewicz LK, McMichael AJ, Wilkinson GW;
#=GF RL   Science. 2000;287:1031.
#=GF DR   INTERPRO; IPR019624;
#=GF CC   This is glycoprotein UL40 from human cytomegalovirus or
#=GF CC   herpesvirus 5. The signal sequence of the UL40 polypeptide
#=GF CC   contains an HLA-E ligand identical with HLA-Cw*0304. The first
#=GF CC   37 residues of UL40, including this ligand, are predicted to
#=GF CC   encode a signal peptide.  The virus thus prevents the lysis by
#=GF CC   NK (natural killer) cells of the cell it has invaded [1-2].
#=GF SQ   1
#=GS UL40_HCMVM/7-220  AC Q6SW92.1
UL40_HCMVM/7-220             TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPVETTVTTAGVTSAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK
#=GC seq_cons                TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPVETTVTTAGVTSAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK
//
DBGET integrated database retrieval system