GenomeNet

Database: Pfam
Entry: UL40
LinkDB: UL40
Original site: UL40 
#=GF ID   UL40
#=GF AC   PF10682.5
#=GF DE   Glycoprotein of human cytomegalovirus HHV-5
#=GF AU   Mistry J, Coggill P
#=GF SE   PRODOM_PD113623
#=GF GA   25.00 25.00;
#=GF TC   32.80 175.20;
#=GF NC   20.40 23.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10799855
#=GF RT   Cutting edge: the human cytomegalovirus UL40 gene product
#=GF RT   contains a ligand for HLA-E and prevents NK cell-mediated lysis. 
#=GF RA   Ulbrecht M, Martinozzi S, Grzeschik M, Hengel H, Ellwart JW, Pla
#=GF RA   M, Weiss EH; 
#=GF RL   J Immunol. 2000;164:5019-5022.
#=GF RN   [2]
#=GF RM   10669413
#=GF RT   Surface expression of HLA-E, an inhibitor of natural killer
#=GF RT   cells, enhanced by human cytomegalovirus gpUL40.
#=GF RA   Tomasec P, Braud VM, Rickards C, Powell MB, McSharry BP, Gadola
#=GF RA   S, Cerundolo V, Borysiewicz LK, McMichael AJ, Wilkinson GW;
#=GF RL   Science. 2000;287:1031.
#=GF DR   INTERPRO; IPR019624;
#=GF CC   This is glycoprotein UL40 from human cytomegalovirus or
#=GF CC   herpesvirus 5. The signal sequence of the UL40 polypeptide
#=GF CC   contains an HLA-E ligand identical with HLA-Cw*0304. The first
#=GF CC   37 residues of UL40, including this ligand, are predicted to
#=GF CC   encode a signal peptide.  The virus thus prevents the lysis by
#=GF CC   NK (natural killer) cells of the cell it has invaded [1-2].
#=GF SQ   173
#=GS A7X8M2_HCMV/7-220   AC A7X8M2.1
#=GS A7X8H0_HCMV/7-220   AC A7X8H0.1
#=GS C8BLC6_HCMV/7-220   AC C8BLC6.1
#=GS H9BQD3_HCMV/10-223  AC H9BQD3.1
#=GS Q6RXH8_HCMV/7-220   AC Q6RXH8.1
#=GS A7X8N2_HCMV/7-220   AC A7X8N2.1
#=GS A5A3M6_HCMV/7-220   AC A5A3M6.1
#=GS Q0QIB5_HCMV/7-220   AC Q0QIB5.1
#=GS A4LAY4_HCMV/7-220   AC A4LAY4.1
#=GS A5A3M7_HCMV/7-220   AC A5A3M7.1
#=GS Q0QI86_HCMV/7-220   AC Q0QI86.1
#=GS V9LS25_HCMV/7-220   AC V9LS25.1
#=GS UL40_HCMVM/7-220    AC Q6SW92.1
#=GS A4LAU1_HCMV/7-220   AC A4LAU1.1
#=GS A7X9I5_HCMV/7-220   AC A7X9I5.1
#=GS Q0QI87_HCMV/7-220   AC Q0QI87.1
#=GS A7X9G7_HCMV/7-220   AC A7X9G7.1
#=GS A7X921_HCMV/7-220   AC A7X921.1
#=GS A5A3L7_HCMV/7-220   AC A5A3L7.1
#=GS D3YRX8_HCMVO/7-220  AC D3YRX8.1
#=GS A4LAV2_HCMV/7-220   AC A4LAV2.1
#=GS A7X8J8_HCMV/7-220   AC A7X8J8.1
#=GS Q0QI85_HCMV/7-220   AC Q0QI85.1
#=GS A4LAZ3_HCMV/7-220   AC A4LAZ3.1
#=GS A7X8R4_HCMV/7-220   AC A7X8R4.1
#=GS H9BQB9_HCMV/7-220   AC H9BQB9.1
#=GS A4LAU7_HCMV/7-220   AC A4LAU7.1
#=GS A5A3M2_HCMV/7-220   AC A5A3M2.1
#=GS A7X9F3_HCMV/7-220   AC A7X9F3.1
#=GS A7X8R7_HCMV/7-220   AC A7X8R7.1
#=GS A7X8W8_HCMV/7-220   AC A7X8W8.1
#=GS B8Y6U9_HCMV/7-220   AC B8Y6U9.1
#=GS Q0QI94_HCMV/7-220   AC Q0QI94.1
#=GS E7DVI9_HCMV/7-220   AC E7DVI9.1
#=GS B8Y6V5_HCMV/7-220   AC B8Y6V5.1
#=GS A4LAV9_HCMV/7-220   AC A4LAV9.1
#=GS A4LAT5_HCMV/7-220   AC A4LAT5.1
#=GS A7X9E3_HCMV/7-220   AC A7X9E3.1
#=GS A7X8W2_HCMV/7-220   AC A7X8W2.1
#=GS A7X928_HCMV/7-220   AC A7X928.1
#=GS A7X9I8_HCMV/7-220   AC A7X9I8.1
#=GS A5A3L9_HCMV/7-220   AC A5A3L9.1
#=GS A4LAU3_HCMV/7-220   AC A4LAU3.1
#=GS A4LAW9_HCMV/7-220   AC A4LAW9.1
#=GS A7X8L9_HCMV/7-220   AC A7X8L9.1
#=GS A7X994_HCMV/7-214   AC A7X994.1
#=GS A8T7B0_HCMV/7-220   AC A8T7B0.1
#=GS A7X9H0_HCMV/7-220   AC A7X9H0.1
#=GS H9BQA8_HCMV/7-220   AC H9BQA8.1
#=GS Q0QIB1_HCMV/7-220   AC Q0QIB1.1
#=GS A7X8W0_HCMV/7-220   AC A7X8W0.1
#=GS Q0QIB2_HCMV/7-220   AC Q0QIB2.1
#=GS A7X9G3_HCMV/7-220   AC A7X9G3.1
#=GS A7X9I6_HCMV/7-220   AC A7X9I6.1
#=GS Q0QI88_HCMV/7-220   AC Q0QI88.1
#=GS A4LAY2_HCMV/7-220   AC A4LAY2.1
#=GS A7X9B2_HCMV/7-220   AC A7X9B2.1
#=GS Q0QIA2_HCMV/7-220   AC Q0QIA2.1
#=GS V9LNV1_HCMV/7-220   AC V9LNV1.1
#=GS A7X8V1_HCMV/7-220   AC A7X8V1.1
#=GS A7X941_HCMV/7-220   AC A7X941.1
#=GS C8CF88_HCMV/7-220   AC C8CF88.1
#=GS Q8UZK3_HCMV/7-220   AC Q8UZK3.1
#=GS C8BKJ6_HCMV/7-220   AC C8BKJ6.1
#=GS V9PSW6_HCMV/7-220   AC V9PSW6.1
#=GS A5A3M1_HCMV/7-220   AC A5A3M1.1
#=GS B8Y6V0_HCMV/7-220   AC B8Y6V0.1
#=GS Q0QIB0_HCMV/7-220   AC Q0QIB0.1
#=GS H9BQD6_HCMV/10-223  AC H9BQD6.1
#=GS H9BQD4_HCMV/10-223  AC H9BQD4.1
#=GS A7X934_HCMV/7-220   AC A7X934.1
#=GS A7X8X2_HCMV/7-220   AC A7X8X2.1
#=GS A7X8Z2_HCMV/7-220   AC A7X8Z2.1
#=GS A7X9J4_HCMV/7-220   AC A7X9J4.1
#=GS B8Y6V7_HCMV/7-220   AC B8Y6V7.1
#=GS H9BQB6_HCMV/7-220   AC H9BQB6.1
#=GS A7X8P6_HCMV/7-220   AC A7X8P6.1
#=GS A7X9C2_HCMV/7-220   AC A7X9C2.1
#=GS A7X986_HCMV/7-220   AC A7X986.1
#=GS A7X9C6_HCMV/7-220   AC A7X9C6.1
#=GS A7X976_HCMV/7-220   AC A7X976.1
#=GS A7X8J7_HCMV/7-220   AC A7X8J7.1
#=GS A7X935_HCMV/7-220   AC A7X935.1
#=GS A7X979_HCMV/7-220   AC A7X979.1
#=GS A7X8Y7_HCMV/7-220   AC A7X8Y7.1
#=GS A7X930_HCMV/7-220   AC A7X930.1
#=GS A4LAS1_HCMV/7-220   AC A4LAS1.1
#=GS A4LAW5_HCMV/7-220   AC A4LAW5.1
#=GS A4LAS2_HCMV/7-220   AC A4LAS2.1
#=GS Q0QI97_HCMV/7-220   AC Q0QI97.1
#=GS A7X8S1_HCMV/7-220   AC A7X8S1.1
#=GS A5A3M4_HCMV/7-220   AC A5A3M4.1
#=GS A7X9B8_HCMV/7-220   AC A7X9B8.1
#=GS Q0QIA0_HCMV/7-220   AC Q0QIA0.1
#=GS H9BQB0_HCMV/7-220   AC H9BQB0.1
#=GS A7X968_HCMV/7-220   AC A7X968.1
#=GS A7X9A5_HCMV/7-220   AC A7X9A5.1
#=GS H9BQB4_HCMV/7-220   AC H9BQB4.1
#=GS A7X9B6_HCMV/7-220   AC A7X9B6.1
#=GS D2K4U2_HCMV/7-220   AC D2K4U2.1
#=GS H9BQC3_HCMV/7-220   AC H9BQC3.1
#=GS A7X8X9_HCMV/7-220   AC A7X8X9.1
#=GS H9BQD0_HCMV/7-220   AC H9BQD0.1
#=GS H9BQD8_HCMV/10-223  AC H9BQD8.1
#=GS C8BKZ3_HCMV/1-205   AC C8BKZ3.1
#=GS B8Y6U4_HCMV/7-220   AC B8Y6U4.1
#=GS A4LAV0_HCMV/7-220   AC A4LAV0.1
#=GS UL40_HCMVA/7-220    AC P16780.1
#=GS UL40_HCMVA/7-220    DR PDB; 2ESV P; 1-9;
#=GS A4LAX9_HCMV/7-220   AC A4LAX9.1
#=GS A7X8I5_HCMV/7-220   AC A7X8I5.1
#=GS Q0QI92_HCMV/7-220   AC Q0QI92.1
#=GS Q0QI92_HCMV/7-220   DR PDB; 3AM8 F; 1-9;
#=GS Q0QI92_HCMV/7-220   DR PDB; 3AM8 E; 1-9;
#=GS A7X8H4_HCMV/7-220   AC A7X8H4.1
#=GS A7X8N5_HCMV/7-220   AC A7X8N5.1
#=GS A5A3M5_HCMV/7-220   AC A5A3M5.1
#=GS H9BQC7_HCMV/7-220   AC H9BQC7.1
#=GS A7X981_HCMV/7-220   AC A7X981.1
#=GS A7X8T8_HCMV/7-220   AC A7X8T8.1
#=GS A7X8X0_HCMV/7-220   AC A7X8X0.1
#=GS H9BQB7_HCMV/7-220   AC H9BQB7.1
#=GS A7X963_HCMV/7-220   AC A7X963.1
#=GS A7X8U9_HCMV/7-220   AC A7X8U9.1
#=GS Q0QIB3_HCMV/7-220   AC Q0QIB3.1
#=GS A7X997_HCMV/7-220   AC A7X997.1
#=GS A4LAX0_HCMV/7-220   AC A4LAX0.1
#=GS A7X9D9_HCMV/7-220   AC A7X9D9.1
#=GS A7X960_HCMV/7-220   AC A7X960.1
#=GS A7X8R3_HCMV/7-220   AC A7X8R3.1
#=GS H9BQD7_HCMV/10-223  AC H9BQD7.1
#=GS A7X8X8_HCMV/7-220   AC A7X8X8.1
#=GS A7X911_HCMV/7-220   AC A7X911.1
#=GS Q0QIA8_HCMV/7-220   AC Q0QIA8.1
#=GS A7X990_HCMV/7-220   AC A7X990.1
#=GS A4LAS9_HCMV/7-220   AC A4LAS9.1
#=GS H9BQD1_HCMV/7-220   AC H9BQD1.1
#=GS A7X8Q8_HCMV/7-220   AC A7X8Q8.1
#=GS V9PV91_HCMV/7-220   AC V9PV91.1
#=GS A7X8G7_HCMV/7-220   AC A7X8G7.1
#=GS A7X9D7_HCMV/7-220   AC A7X9D7.1
#=GS A7X9I3_HCMV/7-220   AC A7X9I3.1
#=GS A7X909_HCMV/7-220   AC A7X909.1
#=GS Q0QIB4_HCMV/7-220   AC Q0QIB4.1
#=GS Q0QI99_HCMV/7-220   AC Q0QI99.1
#=GS A7X9A2_HCMV/7-220   AC A7X9A2.1
#=GS A7X9I1_HCMV/7-220   AC A7X9I1.1
#=GS B8Y6W0_HCMV/7-220   AC B8Y6W0.1
#=GS A7X9E1_HCMV/7-220   AC A7X9E1.1
#=GS A7X8H9_HCMV/7-220   AC A7X8H9.1
#=GS A7X9H7_HCMV/7-220   AC A7X9H7.1
#=GS A7X8Q2_HCMV/7-220   AC A7X8Q2.1
#=GS A7X8T1_HCMV/7-220   AC A7X8T1.1
#=GS F5HEM7_HCMV/7-220   AC F5HEM7.1
#=GS Q0QIA9_HCMV/7-220   AC Q0QIA9.1
#=GS Q0QI90_HCMV/7-220   AC Q0QI90.1
#=GS A7X9B4_HCMV/7-220   AC A7X9B4.1
#=GS A7X905_HCMV/7-220   AC A7X905.1
#=GS A7X8U8_HCMV/7-220   AC A7X8U8.1
#=GS A7X9H9_HCMV/7-220   AC A7X9H9.1
#=GS Q0QI93_HCMV/7-220   AC Q0QI93.1
#=GS A7X8P2_HCMV/7-220   AC A7X8P2.1
#=GS Q0QI89_HCMV/7-220   AC Q0QI89.1
#=GS A5A3M8_HCMV/7-220   AC A5A3M8.1
#=GS A4LAY3_HCMV/7-220   AC A4LAY3.1
#=GS H9BQD2_HCMV/10-223  AC H9BQD2.1
#=GS A4LAX8_HCMV/7-220   AC A4LAX8.1
#=GS A7X9J0_HCMV/7-220   AC A7X9J0.1
#=GS A7X9J9_HCMV/7-220   AC A7X9J9.1
#=GS B8Y6V9_HCMV/7-220   AC B8Y6V9.1
#=GS Q8QS49_9BETA/1-198  AC Q8QS49.1
#=GS H9BQB5_HCMV/7-220   AC H9BQB5.1
#=GS A4LAZ4_HCMV/7-220   AC A4LAZ4.1
#=GS A7X9J5_HCMV/7-220   AC A7X9J5.1
#=GS H9BQD5_HCMV/10-223  AC H9BQD5.1
#=GS A4LAX7_HCMV/7-220   AC A4LAX7.1
A7X8M2_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYAVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8H0_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMKIKSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
C8BLC6_HCMV/7-220              .TRIGFTCAVMAPRTLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD3_HCMV/10-223             .TRIGFTCAVMTPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q6RXH8_HCMV/7-220              .TRIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGAM.SAHGPQCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQECPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8N2_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVDNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3M6_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLVIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIB5_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAY4_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSLYSQIARSLGVLPNDHHYALKK.......
A5A3M7_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI86_HCMV/7-220              .TRIGFTCAAMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
V9LS25_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVMPNDHHYALKK.......
UL40_HCMVM/7-220               .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPVETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAU1_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATLGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9I5_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSDTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI87_HCMV/7-220              .TRIGFTCAVMAPRTLLLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPVDNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9G7_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVLQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X921_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSSLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3L7_HCMV/7-220              .TRIGFTCAVMAPRSLLLAVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
D3YRX8_HCMVO/7-220             .TRIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGAM.SAHGPQCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQECPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAV2_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQDDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGALPNDHHYALKK.......
A7X8J8_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARNLGVLPNDHHYALKK.......
Q0QI85_HCMV/7-220              .TRIGFTCAVMAPWSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRSATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAZ3_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8R4_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGALPNDHHYALKK.......
H9BQB9_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRHADGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAU7_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVRVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3M2_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FTHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9F3_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVSESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8R7_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHLADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8W8_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNERSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
B8Y6U9_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSXCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI94_HCMV/7-220              .TRIGFTCAVMAPRILILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
E7DVI9_HCMV/7-220              .TRIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
B8Y6V5_HCMV/7-220              .TRIGFTCAVMAPRTLVLTLGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYAFKK.......
A4LAV9_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRRTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAT5_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNSTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9E3_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLPHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8W2_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X928_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDRHYALKK.......
A7X9I8_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDVALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3L9_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAV.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVSILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAU3_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLQPATFGLETWAMYTVGILALGSFSSFYSQIARGLGVLPNDHHYALKK.......
A4LAW9_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCPPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8L9_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAAYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X994_HCMV/7-214              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGFCP---------tii....
A8T7B0_HCMV/7-220              .TRIGFTCAVVAPRTLILTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTRRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9H0_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLPCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISRQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQA8_HCMV/7-220              .TRIGFTCAVMAPQSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIB1_HCMV/7-220              .TRIXFTCAVMAPRTLILTVGLLCMRIRSLLXSPAETTVTTAXVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSXNTXVAFSXHXAXNTLLIEVGNNTXRXXDGXSCXDHF.RAQHQDCPAQXVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8W0_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVGGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWVMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIB2_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCAPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9G3_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRDVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9I6_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHRGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI88_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNVHTYALKK.......
A4LAY2_HCMV/7-220              .TRTGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLDEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9B2_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYRCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIA2_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCXRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
V9LNV1_HCMV/7-220              .TRIGFTCAVMAPRTLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDKALMTLDVYCCRQTSNNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8V1_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLTTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X941_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHRGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTRLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
C8CF88_HCMV/7-220              .TRIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTATTAAVT.SAHDPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q8UZK3_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
C8BKJ6_HCMV/7-220              .TRIGFTCAVMAPRTLLLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYPQIARSLGVLPNDHHYALKK.......
V9PSW6_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTRRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3M1_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
B8Y6V0_HCMV/7-220              .TRIGFTCAVTAPRTLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIB0_HCMV/7-220              .TRIGFTCAVMAPRTLILTXGLLCMRIRSLLCSPAETTVTTAXXX.SAHGPXCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSXNTXVXFSXHXAXNTLLIEVGNNTXRXXDGXSCXDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD6_HCMV/10-223             .TRIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD4_HCMV/10-223             .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGLRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYPQIARSLGVLPNDHHYALKK.......
A7X934_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYASKK.......
A7X8X2_HCMV/7-220              i-RIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8Z2_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMKIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9J4_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNERSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
B8Y6V7_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQB6_HCMV/7-220              .TRIGFTCAVMTPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYPQIARSLGVLPNDHHYALKK.......
A7X8P6_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRRVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9C2_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHRYALKK.......
A7X986_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSSYSQIARSLGVLPNDHHYALKK.......
A7X9C6_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGIACQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLPERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X976_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNGSAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8J7_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAIYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X935_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQVARSLGVLPNDHHYALKK.......
A7X979_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGVM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8Y7_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDRISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X930_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHPQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAS1_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPDDHHYALKK.......
A4LAW5_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAS2_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISRQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI97_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8S1_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLEAWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3M4_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9B8_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQNHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIA0_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQB0_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFCLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X968_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCPNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9A5_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTSLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQB4_HCMV/7-220              .TRIGFTCAVMAPRTLLLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYYQSDMALMTLDVYCCRQTSSNTVVAFSHHPVDNTLLLEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9B6_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SGHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYAVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
D2K4U2_HCMV/7-220              .TRIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGITHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQC3_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8X9_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD0_HCMV/7-220              .TRIGFTCAVMAPRILILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD8_HCMV/10-223             .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
C8BKZ3_HCMV/1-205              .---------MAPRTLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
B8Y6U4_HCMV/7-220              .TRIGFTCAVMAPRILLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAV0_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCSLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
UL40_HCMVA/7-220               .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
#=GR UL40_HCMVA/7-220    SS    .XXXXXXXX---S-----XXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......
A4LAX9_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHRPADNALLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8I5_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYASKK.......
Q0QI92_HCMV/7-220              .TRIGFTCAVMGPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPVDNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
#=GR Q0QI92_HCMV/7-220   SS    .XXXXXXXX---SS----XXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......
A7X8H4_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQGCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8N5_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSRCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3M5_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISRQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQC7_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPANNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X981_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQFSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSRGVLPNDHHYALKK.......
A7X8T8_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSKRVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8X0_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPVETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCPDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPDDHHHALKK.......
H9BQB7_HCMV/7-220              i-RIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYPQIARSLGVLPNDHHYALKK.......
A7X963_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDVALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQGHF.RAQHQDCPAQTVRVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSPFYSQIARSLGVLPNDHHYALKK.......
A7X8U9_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTFDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIB3_HCMV/7-220              .TRIGFTCAXMAXRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVXFSHHPADNTLLIEVGNNTRRXXDGISCXDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X997_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPVETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAX0_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQFCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9D9_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVHGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X960_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLSCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYTVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8R3_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLQPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD7_HCMV/10-223             .TRIGFTCAVMAPRTLFVTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8X8_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPFVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X911_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSPFYFQIARSLGVLPNDHHYALKK.......
Q0QIA8_HCMV/7-220              .TRIGFTCAVMAPLTLILTLGLLCMRIRSLLCSPAETTVTTAGXX.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSXNTXVAFSXHXADNTLLIEVGNNTRRXXDGISCXDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X990_HCMV/7-220              .TRIGSTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLSEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAS9_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.FAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYRCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD1_HCMV/7-220              .TRIGFTCAVMAPRSLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8Q8_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQDDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
V9PV91_HCMV/7-220              .TRIGFTCAVMAPRTLVLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8G7_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQNCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9D7_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWTYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLELRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9I3_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMHTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X909_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYRLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIB4_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI99_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQMVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9A2_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALTTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9I1_HCMV/7-220              .TRIGFTCAVMAPRTLILALGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
B8Y6W0_HCMV/7-220              .TRIGFTCXVMAPXTLLLTVGLLCMRIRSLLCSPAETTVTTAXVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSXNTXVAFSXHXAXNTLLIEVGNNTXRXXDGXSCXDHF.RAQHQDCPAQXVHVRGVNESAFGLTHLQSCCXNEHSQLSERVAYHLKLRPATFGLETWAXYTVGILALGSFSSFYSQIARSXGVLPNDHHYALKK.......
A7X9E1_HCMV/7-220              .TRISFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8H9_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDAYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9H7_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMKIKSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGSNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8Q2_HCMV/7-220              .TRIGFTCAAMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8T1_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETMVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
F5HEM7_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPVETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QIA9_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI90_HCMV/7-220              .TRIGFTCAVMAPRSLLLTVGLLCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9B4_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESASGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X905_HCMV/7-220              .THIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8U8_HCMV/7-220              .TRIGSTCAVMAPRTLILTVGLLCMRIRSLLSSSAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9H9_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFPHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI93_HCMV/7-220              .TRIGFTCAVMGPRTLILTLGLLCXRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWVYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPVDNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X8P2_HCMV/7-220              .TRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCCQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q0QI89_HCMV/7-220              .TRIGFTCAVMAPRTLILTXGLLCXRIRSLLCSPAETTVTTAGAX.FAHGPRCPLVFQGWXYAVYHQGDMALMTLDVYCCRQTSXNTXVAFSXHXADNTLLIEVGNNTXRXXDGXSCXDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A5A3M8_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLPERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAY3_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLPCMRIRSLLCSPAETTVTTAAVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTHRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD2_HCMV/10-223             .TRIGFTCAVMTPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYPQIARSLGVLPNDHHYALKK.......
A4LAX8_HCMV/7-220              .TRIGFTCAVMALRTLILTVGLLCMRIRSLLYSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9J0_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYPQIARSLGVLPNDHHYALKK.......
A7X9J9_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLPIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
B8Y6V9_HCMV/7-220              .TRIGFTCAVMAPRTLLLTVGLLCMRIRSLLCSPAETTVTTAXVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSXNTXVAFSXHXAXNTLLIEVGNNTXRXXDGXSCXDHF.RAQHQDCPAQXVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
Q8QS49_9BETA/1-198             m-RTHFMITTMAPKTLLIIVF-LGLPGQMTATTPTTTTGAVISSTpKSNTSYCQKVFEGWVYAMYHKGGMNLMTVDVQCCRPKDNN-----SEKP---ELLIDVGNKTRTG----TCNSHPpSVQPADCHTDIVHVSGLDQSRFYLSSLRSCCLNQPSRLSEKVAYHLRMRPANFGLETWAMYTIGLLGLGSFSSFYPQLIKNLQ------------tyhyagk
H9BQB5_HCMV/7-220              .TRIGFTCAVMTPRTLVLTLGLLCMRIRSLLSSPAETTVTTAGVT.SAHGPLCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTAVAFSRHLAVNTLLIEVGNNTRRRADGVSCLDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAZ4_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPTTFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A7X9J5_HCMV/7-220              .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCPPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
H9BQD5_HCMV/10-223             .TRIGFTCAVMAPRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAHTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
A4LAX7_HCMV/7-220              .TRIGFTCAVMALRTLILTLGLLCMRIRSLLCSPAETTVTTAGAM.SAHGPRCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVSFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
#=GC SS_cons                   .XXXXXXXX---SS----XXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......
#=GC seq_cons                  .TRIGFTCAVMAPRTLILTlGLLCMRIRSLLCSPAETTVTTAGsh.SAHGPhCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADNTLLIEVGNNTRRHVDGISCQDHF.RAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYALKK.......
//
DBGET integrated database retrieval system