GenomeNet

Database: Pfam
Entry: Viral_env_E26
LinkDB: Viral_env_E26
Original site: Viral_env_E26 
#=GF ID   Viral_env_E26
#=GF AC   PF11050.5
#=GF DE   Virus envelope protein E26
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   25.00 25.00;
#=GF TC   530.00 529.80;
#=GF NC   20.60 17.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   17169392
#=GF RT   BV/ODV-E26: a palmitoylated, multifunctional structural protein
#=GF RT   of Autographa californica nucleopolyhedrovirus. 
#=GF RA   Burks JK, Summers MD, Braunagel SC; 
#=GF RL   Virology. 2007;361:194-203.
#=GF DR   INTERPRO; IPR021286;
#=GF CC   E26 is a multifunctional protein. One form of E26 associates
#=GF CC   with viral DNA or DNA binding proteins, while a second form
#=GF CC   associates with intracellular membranes [1].
#=GF SQ   1
#=GS Q8B9N2_NPVR1/1-225  AC Q8B9N2.1
Q8B9N2_NPVR1/1-225             MESVQTRLCASSNQFAPFKKRQLAVPVGSVNSLTHTITSTTVTSVIPKNYQEKRQKICHIISSLRNTHLNFNKIQSVHKKKLRHLQNLLRKKNEIIAELVRKLESAQKKTARRSISKPAHWKYFGVVRCDNTIRTIIGNEKFVRRRLAELCTLYNAEYVFCQARADGDKDRQALASLLTAAFGSRVIVYENSRRFEFINPNEIVSGKRLIIKHLQDESQSDINAY
#=GC seq_cons                  MESVQTRLCASSNQFAPFKKRQLAVPVGSVNSLTHTITSTTVTSVIPKNYQEKRQKICHIISSLRNTHLNFNKIQSVHKKKLRHLQNLLRKKNEIIAELVRKLESAQKKTARRSISKPAHWKYFGVVRCDNTIRTIIGNEKFVRRRLAELCTLYNAEYVFCQARADGDKDRQALASLLTAAFGSRVIVYENSRRFEFINPNEIVSGKRLIIKHLQDESQSDINAY
//
DBGET integrated database retrieval system