GenomeNet

Database: Pfam
Entry: YrzO
LinkDB: YrzO
Original site: YrzO 
#=GF ID   YrzO
#=GF AC   PF14142.4
#=GF DE   YrzO-like protein
#=GF AU   Eberhardt R
#=GF SE   Jackhmmer:C0H458
#=GF GA   27.00 27.00;
#=GF TC   102.20 102.20;
#=GF NC   20.70 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025417;
#=GF CC   The YrzO-like protein family includes the B. subtilis YrzO
#=GF CC   protein Swiss:C0H458 which is functionally uncharacterised. 
#=GF CC   This family of proteins is found in bacteria. Proteins in this
#=GF CC   family are approximately 50 amino acids in length.
#=GF SQ   5
#=GS YRZO_BACSU/1-46    AC C0H458.1
#=GS C2WY20_BACCE/1-46  AC C2WY20.1
#=GS Q81IW9_BACCR/1-46  AC Q81IW9.1
#=GS C2W7I2_BACCE/1-46  AC C2W7I2.1
#=GS Q81VI9_BACAN/1-46  AC Q81VI9.1
YRZO_BACSU/1-46               MFEGLLFFISAGIVCELAAINRNGRKNIKQQAELIQILKENLYKDI..
C2WY20_BACCE/1-46             MLESLLFFFAVGVACELAAINRNGRKKVKQQAELIQLLKELKERKI..
Q81IW9_BACCR/1-46             MLESLLFFFAVGVACELAAINRNGRKKIKQQAELIQLLKELKER--kn
C2W7I2_BACCE/1-46             MSESLLFFLAVGIACELAAINRNGRKKIKQQAEMIQLLKELQER--ka
Q81VI9_BACAN/1-46             MLESLLFFFAVGVACELAAINRNGRKKIKQQAEMIELLKELKERNI..
#=GC seq_cons                 MLESLLFFFAVGVACELAAINRNGRKKIKQQAELIQLLKELKERpI..
//
DBGET integrated database retrieval system