GenomeNet

Database: Pfam
Entry: gp12-short_mid
LinkDB: gp12-short_mid
Original site: gp12-short_mid 
#=GF ID   gp12-short_mid
#=GF AC   PF09089.8
#=GF DE   Phage short tail fibre protein gp12, middle domain
#=GF AU   Sammut SJ
#=GF SE   pdb_1h6w
#=GF GA   25.00 25.00;
#=GF TC   161.40 154.50;
#=GF NC   19.50 17.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   11743729
#=GF RT   Crystal structure of a heat and protease-stable part of the
#=GF RT   bacteriophage T4 short tail fibre. 
#=GF RA   van Raaij MJ, Schoehn G, Burda MR, Miller S; 
#=GF RL   J Mol Biol. 2001;314:1137-1146.
#=GF DR   INTERPRO; IPR015173;
#=GF DR   SCOP; 1h6w; fa;
#=GF CC   Members of this family adopt a right-handed triple-stranded
#=GF CC   beta-helix fold, and are found in the middle of the phage short
#=GF CC   tail fibre protein gp12 [1].
#=GF SQ   1
#=GS FIB12_BPT4/246-326  AC P10930.3
#=GS FIB12_BPT4/246-326  DR PDB; 1H6W A; 246-326;
FIB12_BPT4/246-326             TGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIQQRGGQIIYGTLRIEDTFTIANGGANITGTVRMTGGYI
#=GR FIB12_BPT4/246-326  SS    -HHHHTTSB--SSS--B-EEESSTT--BTTBSSEEE-TT-S---SS-----SS----SS-----SS----SS----S--EE
#=GC SS_cons                   -HHHHTTSB--SSS--B-EEESSTT--BTTBSSEEE-TT-S---SS-----SS----SS-----SS----SS----S--EE
#=GC seq_cons                  TGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIQQRGGQIIYGTLRIEDTFTIANGGANITGTVRMTGGYI
//
DBGET integrated database retrieval system