GenomeNet

Database: Pfam
Entry: gpD
LinkDB: gpD
Original site: gpD 
#=GF ID   gpD
#=GF AC   PF02925.11
#=GF DE   Bacteriophage scaffolding protein D
#=GF AU   Griffiths-Jones SR
#=GF SE   Structural domain
#=GF GA   25.00 25.00;
#=GF TC   41.10 41.00;
#=GF NC   18.70 17.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Bacteriophage_scaffolding_proteins
#=GF RN   [1]
#=GF RM   9305849
#=GF RT   Structure of a viral procapsid with molecular scaffolding. 
#=GF RA   Dokland T, McKenna R, Ilag LL, Bowman BR, Incardona NL, Fane BA,
#=GF RA   Rossmann MG; 
#=GF RL   Nature 1997;389:308-313.
#=GF DR   INTERPRO; IPR004196;
#=GF DR   SCOP; 1al0; fa;
#=GF SQ   78
#=GS A3FJA3_BPPHX/3-143  AC A3FJA3.1
#=GS Q2LLQ6_9VIRU/3-143  AC Q2LLQ6.1
#=GS Q2LLF7_9VIRU/3-143  AC Q2LLF7.1
#=GS Q2LLX2_9VIRU/3-143  AC Q2LLX2.1
#=GS H7UWD6_CAMCO/1-28   AC H7UWD6.1
#=GS A3FJS9_BPPHX/3-143  AC A3FJS9.1
#=GS Q2LM58_9VIRU/3-143  AC Q2LM58.1
#=GS VGD_BPAL3/1-141     AC P08765.2
#=GS A3FJR8_BPPHX/3-143  AC A3FJR8.1
#=GS Q2LLE6_9VIRU/3-143  AC Q2LLE6.1
#=GS F9AV15_VIBCL/3-143  AC F9AV15.1
#=GS D0U127_BPPHX/3-143  AC D0U127.1
#=GS Q2LMB8_9VIRU/3-143  AC Q2LMB8.1
#=GS Q2LL29_BPAL3/1-141  AC Q2LL29.1
#=GS Q2LLT9_9VIRU/3-143  AC Q2LLT9.1
#=GS Q2LLC4_9VIRU/3-143  AC Q2LLC4.1
#=GS E1AND5_BPPHX/3-143  AC E1AND5.1
#=GS Q2LM47_9VIRU/3-143  AC Q2LM47.1
#=GS Q2LLY3_9VIRU/3-143  AC Q2LLY3.1
#=GS D0U138_BPPHX/3-143  AC D0U138.1
#=GS Q2LMC8_9VIRU/2-142  AC Q2LMC8.1
#=GS D0U116_BPPHX/3-143  AC D0U116.1
#=GS Q2LLA2_9VIRU/3-143  AC Q2LLA2.1
#=GS VGD_BPG4/3-143      AC P03638.1
#=GS VGD_BPPHK/1-141     AC Q38039.1
#=GS Q2LLV0_9VIRU/3-143  AC Q2LLV0.1
#=GS Q2LM68_9VIRU/3-143  AC Q2LM68.1
#=GS A3FJM4_BPPHX/3-143  AC A3FJM4.1
#=GS Q2LM16_9VIRU/3-143  AC Q2LM16.1
#=GS G4WZH7_BPPHX/3-143  AC G4WZH7.1
#=GS Q2LL69_9VIRU/3-143  AC Q2LL69.1
#=GS Q2LLP5_9VIRU/3-143  AC Q2LLP5.1
#=GS A3FJB4_BPPHX/3-143  AC A3FJB4.1
#=GS H7UWE3_CAMCO/3-123  AC H7UWE3.1
#=GS VGD_BPS13/3-143     AC P69487.2
#=GS Q2LLJ0_9VIRU/3-143  AC Q2LLJ0.1
#=GS D0U1A0_BPG4/3-143   AC D0U1A0.1
#=GS D0U1B0_BPG4/3-143   AC D0U1B0.1
#=GS Q2LLL2_9VIRU/3-143  AC Q2LLL2.1
#=GS Q2LLK1_9VIRU/3-143  AC Q2LLK1.1
#=GS H0J6N5_9GAMM/3-143  AC H0J6N5.1
#=GS Q2LM37_9VIRU/3-143  AC Q2LM37.1
#=GS C6K2G4_BPST1/1-141  AC C6K2G4.1
#=GS Q2LLN4_9VIRU/3-143  AC Q2LLN4.1
#=GS Q2LLD5_9VIRU/3-143  AC Q2LLD5.1
#=GS H7U397_CAMCO/3-143  AC H7U397.1
#=GS Q2LLW1_9VIRU/3-143  AC Q2LLW1.1
#=GS Q2LLS8_9VIRU/3-143  AC Q2LLS8.1
#=GS Q2LL47_9VIRU/2-142  AC Q2LL47.1
#=GS Q2LL80_9VIRU/3-143  AC Q2LL80.1
#=GS Q2LL58_9VIRU/2-142  AC Q2LL58.1
#=GS Q5C8R9_9VIRU/3-143  AC Q5C8R9.1
#=GS F8RN03_BPPHX/3-143  AC F8RN03.1
#=GS H7UG52_CAMCO/3-143  AC H7UG52.1
#=GS A3FJX3_BPPHX/3-143  AC A3FJX3.1
#=GS D0U1C0_BPG4/3-143   AC D0U1C0.1
#=GS Q2LL91_9VIRU/3-143  AC Q2LL91.1
#=GS Q2LM78_9VIRU/3-143  AC Q2LM78.1
#=GS Q2LM27_9VIRU/3-143  AC Q2LM27.1
#=GS Q2LMA8_9VIRU/3-143  AC Q2LMA8.1
#=GS Q2LLM3_9VIRU/3-143  AC Q2LLM3.1
#=GS Q2LLH9_9VIRU/3-143  AC Q2LLH9.1
#=GS A3FJP6_BPPHX/3-143  AC A3FJP6.1
#=GS Q9G089_BPS13/3-143  AC Q9G089.1
#=GS E1ANB3_BPPHX/3-143  AC E1ANB3.1
#=GS A3FJV1_BPPHX/3-143  AC A3FJV1.1
#=GS A3FJQ7_BPPHX/3-143  AC A3FJQ7.1
#=GS D_BPPHX/3-143       AC P69486.2
#=GS D_BPPHX/3-143       DR PDB; 1TX9 A; 4-143;
#=GS D_BPPHX/3-143       DR PDB; 1CD3 3; 5-143;
#=GS D_BPPHX/3-143       DR PDB; 1CD3 2; 6-140;
#=GS D_BPPHX/3-143       DR PDB; 1AL0 2; 6-138;
#=GS D_BPPHX/3-143       DR PDB; 1CD3 4; 7-143;
#=GS D_BPPHX/3-143       DR PDB; 1CD3 1; 6-143;
#=GS D_BPPHX/3-143       DR PDB; 1AL0 3; 5-143;
#=GS D_BPPHX/3-143       DR PDB; 1AL0 1; 6-143;
#=GS D_BPPHX/3-143       DR PDB; 1AL0 4; 7-143;
#=GS D_BPPHX/3-143       DR PDB; 1TX9 B; 6-135;
#=GS E1ANC4_BPPHX/3-143  AC E1ANC4.1
#=GS Q2LLB3_9VIRU/3-143  AC Q2LLB3.1
#=GS Q2LLR7_9VIRU/3-143  AC Q2LLR7.1
#=GS Q2LLG8_9VIRU/3-143  AC Q2LLG8.1
#=GS Q2LM05_9VIRU/3-143  AC Q2LM05.1
#=GS Q77E75_BPG4/3-143   AC Q77E75.1
#=GS H7TV60_CAMCO/3-143  AC H7TV60.1
#=GS Q2LM98_9VIRU/3-143  AC Q2LM98.1
#=GS Q2LLZ4_9VIRU/3-143  AC Q2LLZ4.1
#=GS Q2LM88_9VIRU/3-143  AC Q2LM88.1
A3FJA3_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLQ6_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLF7_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
Q2LLX2_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
H7UWD6_CAMCO/1-28              ...-----------------------------------------------------------------------------------------------------------------KAAELFAFTLRVRAGNTDVLTDAEENVR
A3FJS9_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINCVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LM58_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQSSAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGLKETVLNAEENAR
VGD_BPAL3/1-141                ...MNIVSDVNYATSVAALRMLQASAVLDVTEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNVQTACLVMEGAEFSENIINGVERPVNAAELFAYTLRIKAGFKETVMDAEENAR
A3FJR8_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINCVERPVKAAELFAFTLRVCAGNTDVLTDAEENVR
Q2LLE6_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
F9AV15_VIBCL/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
D0U127_BPPHX/3-143             ...QVTEQSVRFRTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFALTLRVRTGNTDVLADAEENVR
Q2LMB8_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEDNAR
Q2LL29_BPAL3/1-141             ...MNIVSDVNYATSVAALRMLQASAVLDVTEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNVQTACLVMEGAEFSENIINGVERPVNAAELFAYTLRIKAGFKETVMDAEENAR
Q2LLT9_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLC4_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVECPVKASELFAFTLLVRAGNKDLIGHAETNIR
E1AND5_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LM47_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
Q2LLY3_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
D0U138_BPPHX/3-143             ...QVTEQSVRFQTALASIRLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFALTLRVRAGNTDVLADAEENVR
Q2LMC8_9VIRU/2-142             nsn---ESAVAFATALASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGIDQPVKAAELFAFTLRVRAGNTDHVTHAETNVR
D0U116_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFALTLRVRAGNTDVLADAEENVR
Q2LLA2_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
VGD_BPG4/3-143                 ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFISAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
VGD_BPPHK/1-141                ...MNIVSDVNYATSVAALRMLQASSVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLVMEGAEFSENIINGVERPVNAAELFAYTLRIKAGFKETVIDAEENAR
Q2LLV0_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LM68_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQSSAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGLKETVLNAEENAR
A3FJM4_BPPHX/3-143             ...QVIEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNIDVLTDAEENVR
Q2LM16_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLIDAEENVR
G4WZH7_BPPHX/3-143             ...QVTEQSVRFRTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFALTLCVRTGNTDVLADAEENVR
Q2LL69_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
Q2LLP5_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
A3FJB4_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNIDVLTDAEENVR
H7UWE3_CAMCO/3-123             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAF--------------------
VGD_BPS13/3-143                ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLJ0_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
D0U1A0_BPG4/3-143              ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGALDFVGYPRFPAPVEFISAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
D0U1B0_BPG4/3-143              ksn---ESAVAFQTAIASIKLVQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFISAVIAYYVHPVNIQTACLIMEGAEFTENIVNGIERPVKASELFAFTLLVRAGNKDLIGHAETNIR
Q2LLL2_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLK1_9VIRU/3-143             ..q-ITEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
H0J6N5_9GAMM/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LM37_9VIRU/3-143             .nf--VATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEENAR
C6K2G4_BPST1/1-141             ...MNIVSDVNYATSVAALRMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGALDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLVMEGAEFSENIINGVERPVNAAELFAYTLRIKAGFKETVIDAEENAR
Q2LLN4_9VIRU/3-143             ...QVIEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLCVRAGNTDVLTDAEENVR
Q2LLD5_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
H7U397_CAMCO/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLW1_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLS8_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LL47_9VIRU/2-142             kan---ENAVAFQTAIASIKLIQASSVLDLTEDDFEFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPIEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVDAPVKAAELFAFTLRVRAGNTELITYAENNAR
Q2LL80_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
Q2LL58_9VIRU/2-142             kan---ENAVAFQTAIASIKLIQASSVLDLTEDDFEFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPIEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVDAPVKAAELFAFTLRVRAGNTELITYAENNAR
Q5C8R9_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
F8RN03_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
H7UG52_CAMCO/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
A3FJX3_BPPHX/3-143             ...QVIEQSVRFQTALASIKLIQVSAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNIDVLTDAEENVR
D0U1C0_BPG4/3-143              ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFISAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
Q2LL91_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAFTLLVRAGNKDLIGHAETNIR
Q2LM78_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEENAR
Q2LM27_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEDNAR
Q2LMA8_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEENAR
Q2LLM3_9VIRU/3-143             ..q-ITEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLH9_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
A3FJP6_BPPHX/3-143             ...QVIEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q9G089_BPS13/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGSEFTENIINGVERPVKAAELFAFTLRVCAGNTDVLTDAEENVR
E1ANB3_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRLPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
A3FJV1_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATGRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
A3FJQ7_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHSVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
D_BPPHX/3-143                  ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
#=GR D_BPPHX/3-143       SS    ...XXHHHHHHHHHHHHHHHHHHHSSCTS--HHHHHHHHSSS---GGGHHHHHHHHHHHHHHHHHHTT--SSSBBHHHHHHHHHHHS-HHHHHHHHHHHTTSBSHHHHHCTCEEBB-HHHHHHHHHHHHCTCTTTTHHCCHHHH
E1ANC4_BPPHX/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLB3_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
Q2LLR7_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LLG8_9VIRU/3-143             ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAFTLLVRAGNKDLIGHAETNIR
Q2LM05_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q77E75_BPG4/3-143              ksn---ESAVAFQTAIASIKLIQASSVLDLTEDDFDFLTRDRVWIATDRSRARRAIEACVYGTLDFVGYPRFPAPVEFISAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKASELFAFTLLVRAGNKDLIGHAETNIR
H7TV60_CAMCO/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LM98_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEENAR
Q2LLZ4_9VIRU/3-143             ...QVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVR
Q2LM88_9VIRU/3-143             .nl--VATDVNFATSVAALKMLQASAVLDITEEDFDFLTGDKIWIATDRNRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIVNGVERPVKAAELFAYTLRVKAGFKETVLSAEENAR
#=GC SS_cons                   ...XXHHHHHHHHHHHHHHHHHHHSSCTS--HHHHHHHHSSS---GGGHHHHHHHHHHHHHHHHHHTT--SSSBBHHHHHHHHHHHS-HHHHHHHHHHHTTSBSHHHHHCTCEEBB-HHHHHHHHHHHHCTCTTTTHHCCHHHH
#=GC seq_cons                  .....sEpuVpFQTAlASIKLIQASAVLDLTEDDFDFLTusKVWIATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAELFAFTLRVRAGNpDllscAEENlR
//
DBGET integrated database retrieval system