KEGG   Pseudomonas fluorescens A506: PflA506_0034Help
Entry
PflA506_0034      CDS       T02114                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PflA506_0034 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PflA506_0034 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PflA506_0034 (trpA)
Enzymes [BR:pfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PflA506_0034 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(38713..39522)
Genome map
AA seq 269 aa AA seqDB search
MSRLQTRFAQLKEQNRAALVTFVTAGDPGYDTSLAILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALAAKQNLLKTLQMVREFRQDNNDTPLVLMGYFNPIHKYGVSQFIADAKA
AGVDGLIVVDMPPEHNGELCDPAQAAGIDFIRLTTPTTDDVRLPTVLNGSSGFVYYVSVA
GVTGAGAATLEHVEEAVTRLRRHTDLPISIGFGIRTPDQAAAIARLADGVVVGSALIDHI
ATAKNDQQAIDGVLTLCAALSEGVRNARK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcaaacgcgctttgcgcaacttaaagaacaaaaccgcgccgccctggtg
accttcgtcaccgctggcgaccccggctatgacacctcgctggcgatcctcaagggcttg
ccggccgctggcgccgacgtgatcgaactgggcatgcccttcaccgacccgatggccgac
ggcccggccattcaactggccaatatccgcgcgctggccgccaaacagaacctgttgaaa
accctgcagatggttcgcgagttccgccaggacaacaacgacacgccgctggtgttgatg
ggctatttcaacccgatccataaatatggcgtgtcgcagttcattgccgatgccaaggca
gctggcgtcgacggcctgatcgtggtggacatgccccccgagcacaacggcgagctgtgc
gacccggcccaggccgcaggcatcgactttatccgcctgaccacgccgaccaccgatgat
gtgcgcctgcctactgtgctcaatggcagctccgggtttgtgtattacgtgtcggtcgcc
ggtgttaccggggcgggcgccgccactctggaacacgtcgaagaagccgtgacccgcctg
cgccgtcataccgacctgccgatcagcatcggctttggtatccgcacaccggaccaggca
gcggccatcgcacgcctggcagacggggtggtagtgggttcggcgctgatcgatcacatc
gccacggccaagaacgaccagcaagccattgatggcgtattgaccctgtgcgcggcgctg
tcggaaggtgttcgcaacgcacgcaagtaa

DBGET integrated database retrieval system