KEGG   Pseudomonas fluorescens A506: PflA506_0084Help
Entry
PflA506_0084      CDS       T02114                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pfc  Pseudomonas fluorescens A506
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85277..87337
Genome map
AA seq 686 aa AA seqDB search
MSDDAQRWKEKYLQSIEQQDKLERRWAARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRD
VVRTDDMDAALAALLPRLEKAVLDSEQRRETRVDQISAALTALVTQLQKLPLPREVARPL
KTFAKQLDGRVAQAREIPLLLSELSSLQGQALNNLEPEGEPARPGPGLLQRLFGSKEAAS
EALPVDAEPLPAAQLAPPKPAAPTPAPEPEEPAQSEELTQALRAFAPLSPTPVALKPAPV
AAAGGQEVASDTPLFDAPELPSIAAPAQLSEPDVQAPPVAEPAQESALAAFIEPPPVPVE
TPDETTIGSLSLPPVLEGPEPDELQPDGTYALPDSPEPSYSSVAKHIEGTLLGLLEDLSL
PERHQPQAEAMRERLAHGLNWYELLPILDDLAVLMLAVTDSGQHEFEAYLKQLNERLEAF
QGHLQVASEGHADSSLAARELDTQIREQVDGLQSSVQDAADLDSLKQVLESHLEGLLGTM
DEHQQQRDLREQEVAARLKGLAERVAHMEQEAQGYREHLEVQRQKALLDPLTGLPNRAAW
SERLDYEVNAWHQRGNSLSLAMLDLDHFKRINDGYGHLAGDKVLKIIANVLSKRLRPTDF
IARFGGEEFVLLMPDSALADALAVGEVLREAIAACPFHFKGEPVTITVSMGVAQFQPGER
SDLALKRADEALYRAKAAGRNQVQAA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgcccagcgctggaaagagaaatacctccagagcatcgagcaacaagac
aaactcgaacgccgctgggctgcccgcctcgatttgctgcgccgcgggctggtgcgcagc
acgctggccgccgaaggcaccgaccgagctgtcgaccaatgcatgaaggaaatgcgcgat
gtcgttcgcacggacgacatggatgctgccctcgccgctttactgccacgcctggaaaag
gccgtgctggattcggagcagcgtcgcgaaacccgcgtcgaccagatcagcgccgcgctc
accgccttggtcacccagttgcaaaagctgccgctgccccgcgaggtggctcgtccgctg
aaaaccttcgccaagcaactcgatggtcgcgtggcgcaagcacgggagattccgctgctg
ctcagtgagctgagcagcctgcaggggcaggcgctgaataatctggagcctgaaggcgaa
cccgcacgcccaggcccgggtctgttgcaacgcctgttcggtagtaaagaggccgccagt
gaagcgctcccggttgacgcggagccactgccggcagcgcaattggcaccgccaaagcct
gcagcgcccacacccgcgcccgaaccggaagaacctgcgcaatcggaagaattgacccaa
gccttgcgtgcctttgcaccgctgtcacctacgcccgtggccttgaagcctgcgcctgtt
gcagcggccggagggcaagaggtcgccagcgacacgccgttattcgacgctccagagctg
ccgtcgattgcggcgcctgcgcaattatctgaacccgacgtgcaggcgcctccggttgcg
gagcctgctcaagaaagcgcactcgccgcctttatcgaaccgccgccggttccagtcgaa
acgccggatgaaaccaccatcggcagcctgtcgctgccccctgtgctggaaggtcccgag
cccgacgaactgcaaccggacggcacctacgccctgcctgattcgcctgaaccgtcctat
agttcggtggccaagcacattgaaggcactttgctcggcctgctggaagacctttccctg
cctgaacgtcaccagccccaggccgaggcgatgcgtgaacgtctcgcccatggtttgaat
tggtacgaactgctcccgatcctggatgacctggccgtgctgatgctggcggtcaccgac
agtggccagcatgagttcgaggcttatctcaagcagctcaacgagcgtctcgaggcattc
cagggtcatctgcaggtcgccagcgagggccacgccgacagcagcctggccgcgcgggag
ttggacacgcagattcgcgagcaggtcgacggcctgcaaagcagcgtgcaggacgctgcc
gacctggacagcctcaagcaggtgctcgaaagccatcttgaaggcttgctcggcaccatg
gatgaacaccagcaacagcgtgacctgcgcgaacaggaagtggccgcacgcctcaaaggt
ctggctgaacgcgtggcccatatggagcaggaggcccagggctaccgcgagcacctggag
gtacaacgccagaaggccttgctcgatccgctcaccgggttgcccaaccgtgcggcgtgg
agcgaacgcctcgattacgaagtcaacgcctggcatcagcgcggtaacagcctgtcgctg
gccatgctcgacctggaccacttcaaacgcatcaacgacggctacggtcacctggcaggg
gacaaagtcttgaagatcatcgccaatgtgctgagcaagcgcctgcggccgacggacttc
atcgcgcgtttcgggggtgaagagtttgtgctgctaatgcccgactcggccttggcggat
gccttggccgtaggtgaagtattgcgtgaggctattgcagcgtgcccgttccacttcaag
ggtgagccggtaacgatcacggtgtccatgggcgtggcgcagtttcaacccggcgagcgc
agtgacctggcgctcaagcgtgccgatgaagcgctctacagggcaaaagctgcgggacgt
aatcaggtgcaggcggcataa

DBGET integrated database retrieval system