KEGG   Pseudomonas fluorescens A506: PflA506_1037Help
Entry
PflA506_1037      CDS       T02114                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PflA506_1037 (holC)
   00240 Pyrimidine metabolism
    PflA506_1037 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PflA506_1037 (holC)
   03430 Mismatch repair
    PflA506_1037 (holC)
   03440 Homologous recombination
    PflA506_1037 (holC)
Enzymes [BR:pfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PflA506_1037 (holC)
DNA replication proteins [BR:pfc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PflA506_1037 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1171229..1171657)
Genome map
AA seq 142 aa AA seqDB search
MPQVDFYILPSADPLARLDFACKLTEKAWRMGHRIYLHCSDAAQRDELDARLWRFKGESF
VPHGHAESEPESLVVLGLGDNCGDHHDLLVNLDLKVPAFAQAFARVAEVVVEDPAIRQAA
RESFRFYREQGYPLQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagtcgacttctatatattgcccagcgccgatcccctcgcgcgcctggacttt
gcctgcaaactcaccgaaaaagcctggcgtatgggccatcgcatctacctgcactgcagc
gatgccgcccaacgtgacgaacttgatgcccgtctgtggcgcttcaagggcgaaagcttc
gtgccccacggccacgccgaatccgaacctgaaagcctggttgtgctgggcttgggagac
aactgcggcgatcaccatgacttgctggtcaacctcgacctgaaagtaccggcctttgcc
caagcgttcgcccgtgtggcggaagtggtggtggaagacccggctattcgtcaggccgcg
cgggagagtttccgtttctaccgcgaacagggctatcctctgcaagatcaccggctacaa
cgactttga

DBGET integrated database retrieval system