KEGG   Pseudomonas fluorescens A506: PflA506_1082Help
Entry
PflA506_1082      CDS       T02114                                 

Gene name
ccpA
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pfc  Pseudomonas fluorescens A506
Brite
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PflA506_1082 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1240913..1241878)
Genome map
AA seq 321 aa AA seqDB search
MSNVVNHRSGLMFALCLGTASLSAAPLDEALKPLPAVPVLDPAKVELGRQLFNEPRLSVN
NTLSCASCHQLTSGGADNKPFSIGFDGKPVQINTPSVFNASLNFKQFWNGRVDTLEAQVE
QVVISPVEMGSDWKTVVRNLSALPAYQNAFEQAYPDGVTASNVQNALATYERTLLTPNSR
FDQYVLGNTDILTRQEKYGYQRFKDYGCIACHQGVNIGGNMFQKFGVMGDYFKARGNPLE
SDLGRYLLTQDEEDRHVFKVPSLRNVAVTAPYFHDASAKTLEEAVDVMFKYQLGRNPSQE
DKDLIIQFLKTLTGEWAGKPL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaatgtcgtaaaccaccgttccggcctgatgttcgcgttatgcctgggcaccgca
tcgctgtcagccgcgccgctggacgaagcactcaagcccttgccggcggttccagtactg
gaccctgccaaggttgaattgggtcgccaactgttcaacgagccgcgtttgtcggtcaac
aacaccttgtcctgcgcgagctgtcaccaactgaccagcggcggcgccgacaacaagcca
ttctccattggctttgacggcaaaccggtgcagatcaacaccccgtccgtgttcaacgcc
agcctgaacttcaaacagttctggaacggtcgggtggacacgctggaggcccaggtcgag
caggtggtgatcagcccggtggaaatgggcagcgactggaaaaccgtggtgcgcaacctg
tctgccctgcccgcctaccagaacgcgttcgaacaggcctatcccgatggcgtcaccgct
tccaatgtgcaaaatgccctggccacctacgagcgcacgctgctgacacccaactcgcgg
tttgaccaatacgtgctgggcaacaccgatatcctgacccgccaggaaaaatacggctac
caacgcttcaaggattacggctgcatcgcctgtcaccagggcgtgaacattggcggcaat
atgttccagaagttcggcgtgatgggcgactacttcaaggcccgcggcaacccgctggaa
tcagacctggggcgctacctgctgacccaggatgaagaggaccgccatgtgttcaaggtg
cccagcctgcgcaatgtggccgtcacggcgccgtacttccacgacgcctcggccaagacc
cttgaagaggcggttgacgtaatgttcaagtaccagttggggcgcaacccgtcccaggaa
gacaaggacctgattatccagtttctcaagaccctgaccggtgaatgggcgggcaaaccg
ttatga

DBGET integrated database retrieval system