KEGG   Pseudomonas fluorescens A506: PflA506_1097Help
Entry
PflA506_1097      CDS       T02114                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pfc  Pseudomonas fluorescens A506
Brite
Enzymes [BR:pfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     PflA506_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1260106..1260999
Genome map
AA seq 297 aa AA seqDB search
MNAQGIDLGEGTAGFVLGDGPVGILLIHGLTGTPTELRQVAKGLAKAGNCTVYVPTLAGH
CGDNSDLQATGWQDWYEGVRKTFVQVKQRHGQVFVGGLSMGAVMSMYVASEHPGQVAGLL
MYSTTLKYDGWSINKLAFLTPLLMKIPFGVHICSFEEKPPYGIKNERLRAIVERQMKEGE
SSEAGLLTMEGITVRELHRMNAVVKKRMPQIKVPALVLHSIEDDITSRWNADYVERHLGG
PVTKILLDNCYHMITVDLQYRRVIELSARFVEQHAVLKSTQAPVGAGLPAMASLRSA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgctcaagggatcgacctcggtgaaggcactgccggtttcgttctcggtgatggt
ccggtcgggatcctgttgatccacggcctgaccggcacaccgaccgagttgcgccaggtc
gccaagggcctggccaaggcgggcaactgcacggtgtatgtgcccacgctggccgggcac
tgcggcgacaacagcgacttgcaggccaccggctggcaggactggtacgaaggcgtgcgc
aagaccttcgtacaggtcaagcaacgccacgggcaggtgtttgtcggtggcttgtccatg
ggcgcggtgatgtcgatgtatgtggcgtccgaacacccagggcaagtcgccgggttgctg
atgtattccaccaccttgaagtacgacggctggagcatcaacaaactggcgtttctcacg
cccttgctgatgaagattccgttcggcgtgcacatttgcagcttcgaagagaagccgccc
tatggcattaagaacgagcgcctgcgggccatcgtcgagcggcagatgaaggaaggcgag
agcagtgaggcggggttgctgaccatggaaggcatcaccgtgcgcgagctgcaccgcatg
aacgcggtggtcaagaaacgcatgccccagatcaaggtgccggcgctggtgctgcattcc
atcgaggacgacatcaccagccgctggaacgccgattacgtggagcgccacctcggcggg
ccggtgaccaagatcctgctggacaactgctaccacatgatcacggtcgatttgcagtac
cgccgggtgatcgagttgagtgccaggtttgtcgagcagcacgcagttctaaaatcaacg
caggcccctgtgggagctggcttgcctgcgatggcatcactgaggtctgcctga

DBGET integrated database retrieval system