KEGG   Pseudomonas fluorescens A506: PflA506_1110Help
Entry
PflA506_1110      CDS       T02114                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PflA506_1110 (glpK)
Enzymes [BR:pfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PflA506_1110 (glpK)
Exosome [BR:pfc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PflA506_1110 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275532..1277037)
Genome map
AA seq 501 aa AA seqDB search
MTDLQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFVQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKITGRPIYNAIVWQCRRSTEICQQLK
RDGHEQYISDTTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTVDSWLIWKFTGG
KTHVTDYTNASRTMLFNIHTLEWDAKMLEILDIPREMLPEVKSSSQIYGRTKSGIAIGGI
AGDQQAALFGQMCVEAGQAKNTYGTGCFLLMNTGDKAVKSKHGMLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIINDAHDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTQVERPQMRETTALGAAYLAGLACGFWGSLDELRGKAVIEREFEPQLDEAAKEKL
YAGWQKAVSRTRDWEPHEGAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccttcagaataagaactacatcattgcccttgatcagggcaccaccagttcc
cgggcgatcatcttcgatcgtgacgccaacgtggtgtgtaccgcccagcgtgaattcgtc
cagcactacccgcaggcgggctgggttgaacatgacccgatggaaatcttcgccacccag
agcgcggtgatggttgaggcgctggcccaggccggcctgcaccatgaccaggtggccgcc
atcggtatcaccaaccagcgtgaaaccacggtggtctgggacaagatcaccggccgcccg
atctacaacgctattgtctggcagtgccgccgcagtaccgagatctgccagcagctcaag
cgcgacggccatgagcaatacatcagcgacaccacgggccttgtgaccgacccgtacttc
tccggcaccaagctcaaatggatcctcgacaacgtcgaaggcagccgcgaacgtgcgcgc
aatggcgaactgctgttcggcactgtcgacagctggctgatctggaaatttaccggcggc
aagacccacgtcaccgactacaccaatgcgtcgcgcaccatgctcttcaacatccacaca
ctggagtgggatgcgaagatgctggagattctcgacatcccgcgagaaatgctccctgaa
gtgaagtcatcgtcgcaaatctatggccgtaccaagagcggcatcgctatcggtggcatt
gccggtgaccagcaagcggccctgtttggccagatgtgcgtggaagcgggccaggccaag
aacacctacggcaccggctgcttcctgctgatgaacaccggcgacaaggcggtgaaatcc
aaacacggcatgctcaccaccattgcctgcggcccgcgcggtgaggttgcctatgccctg
gaaggcgcggtcttcaacggcggctccaccgtgcaatggctgcgtgacgagctgaagatc
atcaacgatgcccacgacaccgaatactttgccggcaaggtcaaagacagcaacggcgtg
tacctggtacccgccttcaccggcctcggcgcgccctactgggacccgtatgcccgtggc
gcactgttcggcctgacccgtggcgtacgcgtagaccacattattcgcgcagccctggaa
tcgattgcctaccagacccgcgacgtcctcgacgccatgcaacaggactcgggcgaacgc
ctcaaggccctgcgcgtggacggcggcgcggttgccaacaacttcctgatgcaattccag
gccgacatcctcggcacccaggtagaacgcccgcaaatgcgtgagaccactgccttgggc
gcagcctacctggccggcctggcgtgtggcttctggggcagcctggacgagttgcgcggc
aaagcagtgatcgagcgcgagttcgaaccacagctggatgaagcggccaaagaaaagctc
tatgccggctggcaaaaagccgtgagccgcacccgtgactgggagccgcacgaaggcgcc
gaataa

DBGET integrated database retrieval system