KEGG   Pseudomonas fluorescens A506: PflA506_1110Help
Entry
PflA506_1110      CDS       T02114                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pfc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275532..1277037)
Genome map
AA seq 501 aa AA seqDB search
MTDLQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFVQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKITGRPIYNAIVWQCRRSTEICQQLK
RDGHEQYISDTTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTVDSWLIWKFTGG
KTHVTDYTNASRTMLFNIHTLEWDAKMLEILDIPREMLPEVKSSSQIYGRTKSGIAIGGI
AGDQQAALFGQMCVEAGQAKNTYGTGCFLLMNTGDKAVKSKHGMLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIINDAHDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTQVERPQMRETTALGAAYLAGLACGFWGSLDELRGKAVIEREFEPQLDEAAKEKL
YAGWQKAVSRTRDWEPHEGAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccttcagaataagaactacatcattgcccttgatcagggcaccaccagttcc
cgggcgatcatcttcgatcgtgacgccaacgtggtgtgtaccgcccagcgtgaattcgtc
cagcactacccgcaggcgggctgggttgaacatgacccgatggaaatcttcgccacccag
agcgcggtgatggttgaggcgctggcccaggccggcctgcaccatgaccaggtggccgcc
atcggtatcaccaaccagcgtgaaaccacggtggtctgggacaagatcaccggccgcccg
atctacaacgctattgtctggcagtgccgccgcagtaccgagatctgccagcagctcaag
cgcgacggccatgagcaatacatcagcgacaccacgggccttgtgaccgacccgtacttc
tccggcaccaagctcaaatggatcctcgacaacgtcgaaggcagccgcgaacgtgcgcgc
aatggcgaactgctgttcggcactgtcgacagctggctgatctggaaatttaccggcggc
aagacccacgtcaccgactacaccaatgcgtcgcgcaccatgctcttcaacatccacaca
ctggagtgggatgcgaagatgctggagattctcgacatcccgcgagaaatgctccctgaa
gtgaagtcatcgtcgcaaatctatggccgtaccaagagcggcatcgctatcggtggcatt
gccggtgaccagcaagcggccctgtttggccagatgtgcgtggaagcgggccaggccaag
aacacctacggcaccggctgcttcctgctgatgaacaccggcgacaaggcggtgaaatcc
aaacacggcatgctcaccaccattgcctgcggcccgcgcggtgaggttgcctatgccctg
gaaggcgcggtcttcaacggcggctccaccgtgcaatggctgcgtgacgagctgaagatc
atcaacgatgcccacgacaccgaatactttgccggcaaggtcaaagacagcaacggcgtg
tacctggtacccgccttcaccggcctcggcgcgccctactgggacccgtatgcccgtggc
gcactgttcggcctgacccgtggcgtacgcgtagaccacattattcgcgcagccctggaa
tcgattgcctaccagacccgcgacgtcctcgacgccatgcaacaggactcgggcgaacgc
ctcaaggccctgcgcgtggacggcggcgcggttgccaacaacttcctgatgcaattccag
gccgacatcctcggcacccaggtagaacgcccgcaaatgcgtgagaccactgccttgggc
gcagcctacctggccggcctggcgtgtggcttctggggcagcctggacgagttgcgcggc
aaagcagtgatcgagcgcgagttcgaaccacagctggatgaagcggccaaagaaaagctc
tatgccggctggcaaaaagccgtgagccgcacccgtgactgggagccgcacgaaggcgcc
gaataa

DBGET integrated database retrieval system