KEGG   Pseudomonas fluorescens A506: PflA506_1134Help
Entry
PflA506_1134      CDS       T02114                                 

Definition
hypothetical protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PflA506_1134
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PflA506_1134
  Energy metabolism
   00680 Methane metabolism
    PflA506_1134
Enzymes [BR:pfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PflA506_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301017..1303704
Genome map
AA seq 895 aa AA seqDB search
MNHVINSILENASTRPSIGHTNPALLHDVLWRALEHALKANTDDASHTPHARACLRIYAE
IDTLSYLDKGDSKLAAALGKAFFESRSSKDVEAFWKLLLIKQLLFELSVRGVATQIASQA
SLPRQLLTLDPQLIAASAGVNISLGVLCKETDQLKHSVVLVLQKLAQHVEDRGLKKPQVT
AQLLLELYNAVWSGSNGTDIESQIFYADSVYDALPDVHHALGLAPQEKWLTLFTWLYGDK
DGRPYDTNQHTETLVVALETALRNRYIADIDSLIKDGGARHRLEEIRARVGKDHPEHFKR
PAELIDALSSIRFTQPAAIDRLLLRVHAFGFHYLDIEFRENAEMFSCVVNEILSSQWLET
IGLGQGRHYHELDERARQAALEVALEGGAARTPAALWQEYLQRTTPIYTRKVEQYAGQDY
IALMEQDPSYIRMHDARNAVERFEMIDRYRDRMKIHGIAEYTSALSALEVLFLMKAAQVR
DGIDIALQPEDLAGAERTVATVHEVYENPVYRQHLATRGNRQYITFGPSDTGKQGGKAMH
KLNMAIANQHKLIAARYGIEVVVHVIMGGEHARCNGVIAETLQEFGALEGPETRFMLAGC
AEMRAHLLTRNQSVNFLSQLYRMHAEPKPQPSEEVIAGRVQRWGGVVRRYQATFFEHPAL
PSLLRDLARFDVVRATAKGTRPPSRIFNIKVFESRPDAIRAIPWTRALLAGGLHSELIGV
GQFAQEPATCLSKAFNEDESFHTYVKGMAYAIARTDLKCAWLTLTGSIPEKAHIQRLAQA
LKTEAVGTAEQLLASLHLEVIEGKRFVYKATNGTEPADPWKIKEGSLLNLWPSLRAEVYL
KEKNLRIYRLFLIYAKSNPAFIQSSSLNDFYSGFLAAVSTDAGLVDPASAHHFTW
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgtgatcaactccatactggaaaatgcatcaactcgcccctcaatcggccat
accaaccccgcgctactgcatgacgtcctatggcgagccctggagcacgcactcaaggcc
aacacggatgatgcttcccacaccccgcatgcccgtgcctgtctcaggatctatgctgaa
atcgatacgctgtcgtatctggacaagggtgattcgaaattggccgcagctctgggcaag
gcgttcttcgaatcgcgctccagcaaagacgtcgaggcattctggaagttgttactgatc
aagcaactgctgttcgaattgtcggtcaggggtgtggcgacccagattgcttcgcaagcc
agtctgcctcgtcagttgctcacgctcgatccgcagttgattgcagcgtctgcgggcgtg
aatatcagcctgggagtgctgtgcaaagaaaccgatcagctcaagcattccgttgtgctg
gtcttgcagaaactggcacagcacgtcgaggatcgtggcctgaaaaagcctcaagtcact
gcgcagcttctgctggagttgtacaacgccgtgtggtcgggcagtaatggcaccgatatc
gagtcacagattttttacgccgacagtgtgtatgacgcgttgcccgacgtgcatcacgcc
ctgggcctggcgccgcaggaaaaatggctgactttgttcacctggttatacggcgacaag
gatggccgcccctatgacaccaaccagcacaccgaaaccctggtggtggcgctggaaacg
gcgctgcgcaatcgctacatcgctgatatcgacagtctgatcaaggacggcggcgcacgg
catcgccttgaagagattcgtgctcgcgtgggcaaggatcatcccgagcatttcaagcgt
cccgccgaactgatcgacgcactgagcagcatccgttttacccagcccgccgccatcgac
cgtctgctgctgcgggtgcatgcgtttggctttcactatctggatatcgagtttcgtgaa
aacgccgagatgttcagctgcgtggtcaatgagatcctttccagtcagtggctggaaacc
atcggcctgggccagggccggcactatcacgagctggatgagcgtgcgcgtcaggccgcc
cttgaggtcgcgctggagggcggggcggcccggacgcccgctgccctgtggcaggagtat
ttgcaacgcaccacgccgatttacacgcggaaagtcgagcaatatgccggccaggattac
attgcgctgatggagcaggatccgagctatatccgcatgcacgatgcgcgcaacgcggtg
gaacggtttgaaatgattgaccgttatcgcgaccggatgaaaatccacgggatcgccgag
tacacctcggccctcagcgcgctggaggtgctgttcctgatgaaagcggcccaggtacgg
gacgggattgacatcgctctgcaacctgaagacctggcaggtgccgagcgcacggtggcc
acggtgcatgaggtgtacgaaaacccggtgtaccgccagcacctggcaacgcgcggcaac
cgccaatacatcacgtttggccccagcgacacgggcaagcaaggcggcaaggccatgcac
aagctgaacatggcgattgccaaccagcacaagttgatcgcggcccgttatggcatcgag
gtggtcgtccacgtcatcatgggcggggaacacgcacggtgtaatggggtgatcgccgag
accttgcaggagttcggcgcgctggagggcccggaaacccgcttcatgctggccggctgc
gcggagatgcgcgctcatctgctgacccgcaaccagtccgtcaactttctcagccagttg
taccgtatgcacgccgagcccaagccgcagccgtccgaggaggtcattgccggcagggtt
caacgttgggggggcgtggtgcgccgctaccaggcgacgttcttcgagcatccggcgctg
ccttccctgctgcgggacctggcgcgattcgatgtggtcagggccaccgccaaaggcacc
cggccgccttctcgtatcttcaacatcaaggtgttcgagtcgcgtcccgatgccattcgt
gcgattccctggacccgcgccttgctggccggtggattgcacagcgaactgatcggcgtc
gggcagtttgcgcaagagccggcaacttgcttgtccaaggccttcaacgaggatgagagc
tttcacacctacgtcaaaggcatggcctacgccattgcgcgaaccgacctcaaatgcgcc
tggctgaccctgaccggcagcatcccggaaaaggcccacatccagaggctggcgcaagcc
ttgaagaccgaagccgtcggtaccgccgaacagctgctggccagcctgcacctggaagtg
attgaaggtaagcgcttcgtgtacaaagccaccaacggcaccgagccggcggatccatgg
aaaatcaaggaaggcagcttgctcaacctatggcccagcctcagggccgaggtctatctc
aaggaaaagaacttgcgaatctatcgcttgtttctgatctacgccaaaagcaatcccgcg
ttcatccagtcgtcatcgctgaatgatttctacagcgggttcctcgcggccgtgagtacc
gatgcaggtttggtcgatcccgcaagcgcccaccatttcacctggtga

DBGET integrated database retrieval system