KEGG   Pseudomonas fluorescens A506: PflA506_1189Help
Entry
PflA506_1189      CDS       T02114                                 

Definition
response regulator domain/methylesterase, CheB family
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347614..1348624
Genome map
AA seq 336 aa AA seqDB search
MRIAIVNDMPLAVEALRRALSYEPAHEVVWVASNGLEAVQRCAELTPDLILMDLIMPVMD
GVEATRQIMADTPCPIVIVTVDRQANVSRVFEAMGHGALDVVDTPALGVGNPKDAAAPLL
RKILNIGWLIGQRGTRVRAETPPQRVTGKRQRLVAIGSSAGGPAALEVLLKGLPRDFPAA
IVLVQHVDQVFAAGMAEWLSSASGLPVRLACEGEPPQPGVVLLAGTNHHIRLLKNGTLAY
TAEPVNEIYRPSIDVFFESVASHWNGDAVGVLLTGMGRDGAQGLKLMREQGYLTIAQDQQ
SSAVYGMPKAAAAIDAAVEIRPLDRIAPRLLEVFAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgcgatcgtcaatgacatgcccctggccgtagaggccttgcgccgtgccttg
agttacgagcccgcccacgaggtggtgtgggtggccagcaatggcctggaagcggtgcag
cgttgcgccgagctgaccccggacctgatcctgatggacttgatcatgccggtgatggac
ggcgtggaagctacccgccagatcatggccgacacgccatgcccgatcgtgatcgtcaca
gttgaccgccaggccaacgtcagccgtgtattcgaagccatgggccacggcgccctggat
gtggtggacaccccggcactgggcgtgggcaaccccaaggatgcggcggcgcccctgttg
cgcaagatcctcaatattggctggctgatcggccagcgcggcacgcgggtgcgtgccgaa
accccgccgcagcgggtcaccggcaagcgtcaacggctggtggcgattggttcttcggcc
ggtgggccggcggccctggaagttctgctcaaggggttgccccgggatttccctgccgcc
atcgtgctagtgcagcatgtggaccaggtgtttgccgctggcatggccgagtggctgagc
agcgcttccggcctgccggtgcgcctggcctgtgaaggcgagccgcctcaacccggcgtg
gtattgctggccggcaccaaccaccatattcgcttgttgaaaaatggcacgctagcctat
accgcagagccggtgaacgagatttaccggccgtcgatcgacgtgtttttcgaaagcgtc
gccagccactggaacggtgacgccgtcggtgtcttgctcacgggcatggggcgcgacggc
gcccagggcctcaagctgatgcgggaacaaggatatttgaccatcgcccaggaccaacag
agttcggcggtgtatggcatgcccaaagcggcggcggcgattgatgctgctgttgaaatt
cgcccactggatagaattgcgccccgattgctggaggtctttgcaaaatga

DBGET integrated database retrieval system