KEGG   Pseudomonas fluorescens A506: PflA506_1262Help
Entry
PflA506_1262      CDS       T02114                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfc  Pseudomonas fluorescens A506
Brite
Enzymes [BR:pfc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PflA506_1262 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425514..1426191
Genome map
AA seq 225 aa AA seqDB search
MAREQDDLLRRGIGMTSQRTRERLIQRLYEEGLSNAQVLEVIRRTPRHLFVDEALAHRAY
EDTALPIGHNQTISQPYMVARMSELLLAAGPLDKVLEIGTGSGYQTAVLSQLVERVFSVE
RIKVLQDRAKERLVELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAP
GGRLVIPVGSGEVQQLMLIIREDEGFSRHVLGAVRFVPLLNGPLA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgaacaagacgacttgttgcgccgcggcatcgggatgacctcccagcgcacc
cgggagcggttgatccagcgtctgtatgaagaaggcttgtccaacgcacaggtgctggaa
gtaatccgacgcacgccgcggcatctgtttgttgatgaggcactggcgcatcgcgcctat
gaagacacagcgttgcccatcggccacaaccagaccatctctcagccctatatggttgcg
cgtatgagcgagctattgctggcggcggggccgttggacaaggtgctggagattggtacc
ggttctggctatcagacggccgtgctgtcgcaattggtagagcgagtgttttcggtcgag
cgcatcaaggtgctacaggaccgggccaaagagcgtctggtggagctgaacctgcgcaac
gtggtattccgctggggcgatggctgggagggctggccggcgctggcgccctacaacggt
atcatcgtcaccgccgtggccaccgatgtgccgcaagccttgctggatcaattggcacct
ggcgggcggctggtcatcccggtgggctccggcgaagtgcaacagttgatgcttattatc
cgtgaggacgaaggtttttcccggcatgtactcggtgccgtgcgtttcgtccccttgctc
aacggcccgctggcctga

DBGET integrated database retrieval system