KEGG   Pseudomonas fluorescens A506: PflA506_1567Help
Entry
PflA506_1567      CDS       T02114                                 

Gene name
fadB
Definition
fatty oxidation complex subunit alpha (EC:4.2.1.17 5.3.3.8 1.1.1.35 5.1.2.3)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PflA506_1567 (fadB)
   01212 Fatty acid metabolism
    PflA506_1567 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PflA506_1567 (fadB)
   00650 Butanoate metabolism
    PflA506_1567 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PflA506_1567 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PflA506_1567 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PflA506_1567 (fadB)
   00310 Lysine degradation
    PflA506_1567 (fadB)
   00380 Tryptophan metabolism
    PflA506_1567 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PflA506_1567 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PflA506_1567 (fadB)
   00281 Geraniol degradation
    PflA506_1567 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PflA506_1567 (fadB)
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PflA506_1567 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PflA506_1567 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PflA506_1567 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PflA506_1567 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1729408..1731555
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADFRVMSATAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENKAEDAL
KVGAVDAVVAPDKLAEAALSLIKGAISGEFDYKAKRQPKLEKLKLNAIEQMMSFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIAKDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEAQVK
DDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYEADKKGKQ
KKVADPSVHEVLAPVIYEQREVSDEDIINWMMIALCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADKYADLGPLYHPTAKLREMAKNGQSFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaactc
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaacgaactg
cgtcaggccgtagacaccatcaaagcagatgcttcggtcaagggcgtgatcgtctccagc
ggcaaggacgtgtttatcgtcggcgctgacatcaccgaattcgtcgacaacttcaagctg
cccgatgccgagctggtggctggcaacctcgaagccaacaagatcttcagcgatttcgaa
gacctcaacgtgccgactgttgctgccatcaacggcatcgcgttgggcggcggcctggaa
atgtgcctggcggcagacttccgtgtcatgtccgcgacggccaagatcggcctgccggaa
gtcaagctgggcatctacccaggctttggcggtacggtgcgcctgccgcgcctgatcggt
gccgacaacgcgatcgaatggatcgccgccggtaaggaaaacaaggctgaagacgcgctg
aaagtcggtgccgtcgacgcagtagtggctccggacaaactggccgaagccgcgctgagc
ctgatcaaaggcgccatcagcggcgaatttgactacaaggccaagcgtcagccgaagctg
gaaaaactcaagctcaacgccatcgaacagatgatgtcgttcgaaaccgccaaaggtttc
gtggcaggccaggccggcccgaactacccggcgccggttgaagcgatcaagaccatccag
aaggccgcgaactttggtcgcgacaaagccctggaagtggaagcggcaggcttcgtcaaa
ctggcgaaaacctcggcggcccagagcctgatcggcctgttcctgaacgatcaggaactg
aagaaaaaggccaaggcctacgacgaaatcgccaaggacgtgaaacaggccgccgtactc
ggcgccggtatcatgggcggcggtatcgcctatcagtcggcgtccaaaggcacgccgatc
ctgatgaaagacatcaacgagcacggtatcgaacagggcctggccgaagccgccaagctg
ctggtgggccgcgttgataaaggtcgtatgaccgctgcaaaaatggctgaagtgctcaac
ggcattcgtcctacgctgtcctacggtgatttcggccacgtcgacctggtggtcgaagcg
gttgtcgaaaacccgaaggtcaagcaggcggtactggctgaagtggaagcccaggtcaaa
gatgacaccatcctggcctccaacacctcgaccatttccatctcgctgctggccaaggcc
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgagctggccgtggccaccaccgttgcc
tacgccaagaaaatgggcaagaacccgatcgtcgtcaacgattgcccgggcttcttggtc
aaccgcgtgctgttcccgtactttggcggtttcgccaagctggtcagcgccggtgtggac
ttcgtgcgcatcgacaaggtcatggagaagttcggctggcccatgggcccggcgtacctg
atggacgtggtcggtatcgacaccggccaccacggtcgcgacgtcatggctgaaggcttc
ccggaccgcatgaaagacgaccgccgctcggcgatcgacgcgctgtacgaggccaagcgc
ctgggccagaagaatggcaagggcttctacgcctacgaggccgacaagaagggcaagcag
aagaaagtggccgacccgtcggtgcacgaagtgctcgctccggtcatctacgaacagcgt
gaggtgtcggacgaagacatcatcaactggatgatgatcgccctgtgcctggaaaccgtg
cgttgcctggaagacggcatcgttgaaaccgccgccgaagccgatatgggcctggtgtac
ggtattggtttccctccattccgtggtggcgcgttgcgttacatcgattcgatcggtgtg
gccgagttcgttgccctggctgacaaatacgctgatttgggcccgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaatggccagagcttcttcggttaa

DBGET integrated database retrieval system