KEGG   Pseudomonas fluorescens A506: PflA506_1576Help
Entry
PflA506_1576      CDS       T02114                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PflA506_1576 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PflA506_1576 (nagZ)
Enzymes [BR:pfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PflA506_1576 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1739760..1740770
Genome map
AA seq 336 aa AA seqDB search
MTAALQGSLMVDVAGTWLTAEDRHLLRQPEVGGLIIFARNIEHPRQVRELSAAIRAVRPD
LLLAVDQEGGRVQRLRQGFVRLPAMRALADNPNAEYLAEQCGWIMATEALAVGLDLSFAP
VLDLDYQRSAVVGTRAFEGDPERAAVLAGAFIRGMNSAGMAATGKHFPGHGWAEADSHVA
IPNDERSLEQIRANDLVPFARLSKQLAAVMPAHVIYPQVDAQPAGFSRRWLQDILRGELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALSAAQRMKVTPS
ARIARMRGQAVASTDYKQDPRWLTALTALRDAQLID
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgccctacaaggttctttgatggtcgacgtcgccggtacctggctcacggcc
gaggatcgtcatctgttgcgccaaccggaagtgggcggcctgattatttttgcgcgcaat
atcgagcacccgcgccaggttcgcgagttgagcgccgcgattcgtgcagtgcgcccggac
ttgctgttggccgtggaccaggagggcggtcgcgtgcagcgtctgcgccaaggcttcgtg
cgcctgccggccatgcgtgcgctggcggataaccccaacgctgaatacctggccgaacag
tgcggctggatcatggccaccgaggcgctggcggtgggcctggacctgagttttgccccc
gtgctggacctcgactaccaacgcagcgccgtggtcggtacccgtgctttcgaaggcgac
cccgagcgcgctgccgtgctcgcgggtgcctttatccgtggcatgaacagcgccggcatg
gccgccaccggcaagcacttccctggccatggttgggccgaggccgattcccacgttgcc
attcccaatgatgaacgcagcctggagcagattcgcgccaacgacctggtgcctttcgca
cgcctgagcaagcaattggccgccgtgatgccggcgcacgtcatctacccgcaggtcgat
gcccagcctgctggtttttcgcgccgctggttgcaggacatcctgcgcggtgagttgcag
tttgacggggtaatcttcagcgatgacctgtccatggccggcgcccatgtggtcggcgat
gcggccagccgtatcgaagcggcgctgaccgccggttgtgacatgggcttggtgtgcaat
gaccgtgcggcggccgagctggcgctcagtgcagcacagcggatgaaggtcacgccgtcg
gcgcggattgcgcgtatgcgtgggcaggcggttgcctcgacggactataagcaggacccg
cgttggctgacagcgcttactgcgttgcgtgatgcgcagttgatcgactga

DBGET integrated database retrieval system