KEGG   Pseudomonas fluorescens A506: PflA506_1699Help
Entry
PflA506_1699      CDS       T02114                                 

Gene name
aroA
Definition
prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase (EC:1.3.1.12 2.5.1.19)
Orthology
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pfc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1859204..1861414
Genome map
AA seq 736 aa AA seqDB search
MIGRLVVVGLGLIGGSFAKGLRESGLCGEVVGVDLDPQSRTLAVELGVVDRCEADLAVAC
QGADVIQLAVPILAMEKLLAVLAGMDLGQAILTDVGSAKGNVVRAARLAFGGMPPRFVPG
HPIAGSEQSGVEASNAQLFRRHKVILTPLAQTDPTALAVVDRLWRELGADVEHMQVERHD
EVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDPVMWHDIFLANR
EAVLRTLDTFRSDLDALRDAVDAGDGHQLLGVFTRARVAREHFSKILARRAYMETAVNTD
DLTFIASPGGRLSGRIRVPGDKSISHRSIMLGSLAEGVTEVEGFLEGEDALATLQAFRDM
GVVIEGPHHGRVTIHGVGLQGLKAAPGPIYVGNSGTSMRLLAGVLAAQRFDSVLTGDASL
SKRPMNRVAKPLREMGAIIETGPDGRPPLSIRGGQSLKGLNYVLPMASAQVKSCLLLAGL
YAEGKTSVTEPAPTRDHTERMLRGFGYPVAVQGATASLASGHGLTATRIEVPGDISSSAF
FLVAASIAEGSELLLEHVGINPTRTGVIDILRLMGADITLENQREVGGEPVADLRVRAAA
LKGIEIPEALVPLAIDEFPVLFIAAACAQGRTVLRGAEELRLKESDRIQVMADGLLALGV
KCEPTPDGLIIDGGPMGGGEVHAHGDHRIAMAFSVASLRATAPIRILDCANVATSFPNFL
TLCAQVGIRVAQEAQL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcctggtggtggtcggtctggggttgattggcggctccttcgccaaaggc
ctgcgtgaaagcgggctatgtggcgaagtggtgggggtggacctcgacccgcaatcgcgc
acgttggcggtggagttgggggtggtggaccgctgtgaggcggacctggccgttgcgtgc
cagggcgcggatgtgatccagcttgccgtgccgatcctggccatggagaagttgctggcg
gtactggcgggcatggacctcgggcaagcgatccttaccgatgtgggtagcgccaaaggc
aacgtggtgcgcgcggcacgattggcgtttggtggcatgccgccgcgctttgtgccgggt
catcccatcgcgggttccgagcagagcggggtggaggcctccaatgcgcagttgtttcgt
cggcataaggtcatcctgacgccgcttgcgcaaaccgatcccacggcgttggcggtggtg
gatcgtctctggcgcgagctgggcgcggatgtggagcatatgcaggtcgagcgtcacgac
gaagtgttggcagccaccagccacttgccgcatctgctggcatttggcttggtggattct
ttggccaagcgcaacgagaacctcgagattttccgttacgccgccggcggcttccgcgat
tttacgcggattgccggcagcgatccggtgatgtggcacgacatcttcctcgccaatcgc
gaagcggtgttgcgcaccctggacaccttccgcagtgatctcgacgccttgcgcgacgcg
gtggatgcgggagacggccatcaactgctgggcgtgttcacccgggcacgggtggcgcgt
gaacatttcagcaagattctcgcacgccgggcctatatggaaaccgcagtgaacaccgat
gatctgaccttcatcgccagcccgggtggccgcttgagcgggcgcatccgcgtgccgggt
gacaagtcgatctcccatcgctcgatcatgctgggctcgttggccgagggtgtgaccgag
gtggaaggcttccttgagggtgaggacgccctggcgaccttgcaggcctttcgcgacatg
ggcgtggtgatcgagggcccgcaccatgggcgcgtgaccattcacggtgtcggcctgcag
ggcctgaaggcagcgccggggccgatctacgtgggcaattccggcacgtcgatgcgcctg
ttggccggtgtattggcggcgcagcgcttcgacagcgtgttgaccggcgatgcctcgctg
tccaagcgcccgatgaaccgcgtggccaagccgctgcgtgaaatgggtgcgatcatcgag
accgggccggacgggcgtccgccactgagcattcgtggcgggcaatcgctcaaaggcttg
aactatgtactgcccatggccagtgcccaggtgaaatcctgcctgttgttggcggggtta
tacgctgagggtaaaacctcggtgaccgagcccgcaccgacccgcgaccacaccgagcgc
atgctgcgcggctttggctacccggtggcggtgcagggcgcgacggcgtcgctggcgtcg
gggcatgggttgaccgctacgcgtattgaagtgccaggggatatttcgtcttcggcgttt
ttcctggtggcggcctcgattgccgaaggctccgagctgttgctggagcatgtcggtatc
aacccgacccgcaccggtgtgatcgacatcctgcggctgatgggggctgatatcaccctc
gaaaatcagcgtgaggtgggcggcgagccggttgcggatttacgtgtgcgtgctgccgcg
ctcaagggtatcgagattccagaggccctggtgccgttggcgattgatgagtttcccgtg
ctgtttattgccgcagcctgcgctcaggggcgtactgttttacgcggggccgaagagctg
cgcctcaaggagtccgatcgcatccaggtgatggccgacggtctgttggctctgggcgtg
aagtgtgaacccacgcctgatgggcttatcattgacggtggcccgatgggcggcggtgaa
gtgcatgcccatggcgatcatcggattgccatggcgttcagtgtggcttccctgcgggcg
acggcgcctattcgtatccttgactgcgccaatgttgctacgtcttttccgaactttctg
acactgtgtgcccaagtcggcatccgtgttgcccaagaggctcaattgtga

DBGET integrated database retrieval system