KEGG   Pseudomonas fluorescens A506: PflA506_1699Help
Entry
PflA506_1699      CDS       T02114                                 

Gene name
aroA
Definition
(GenBank) prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01130  Biosynthesis of antibiotics
pfc01230  Biosynthesis of amino acids
Module
pfc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PflA506_1699 (aroA)
Enzymes [BR:pfc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     PflA506_1699 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase PDH F420_oxidored IlvN TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFJ59769
Position
1859204..1861414
Genome map
AA seq 736 aa AA seqDB search
MIGRLVVVGLGLIGGSFAKGLRESGLCGEVVGVDLDPQSRTLAVELGVVDRCEADLAVAC
QGADVIQLAVPILAMEKLLAVLAGMDLGQAILTDVGSAKGNVVRAARLAFGGMPPRFVPG
HPIAGSEQSGVEASNAQLFRRHKVILTPLAQTDPTALAVVDRLWRELGADVEHMQVERHD
EVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDPVMWHDIFLANR
EAVLRTLDTFRSDLDALRDAVDAGDGHQLLGVFTRARVAREHFSKILARRAYMETAVNTD
DLTFIASPGGRLSGRIRVPGDKSISHRSIMLGSLAEGVTEVEGFLEGEDALATLQAFRDM
GVVIEGPHHGRVTIHGVGLQGLKAAPGPIYVGNSGTSMRLLAGVLAAQRFDSVLTGDASL
SKRPMNRVAKPLREMGAIIETGPDGRPPLSIRGGQSLKGLNYVLPMASAQVKSCLLLAGL
YAEGKTSVTEPAPTRDHTERMLRGFGYPVAVQGATASLASGHGLTATRIEVPGDISSSAF
FLVAASIAEGSELLLEHVGINPTRTGVIDILRLMGADITLENQREVGGEPVADLRVRAAA
LKGIEIPEALVPLAIDEFPVLFIAAACAQGRTVLRGAEELRLKESDRIQVMADGLLALGV
KCEPTPDGLIIDGGPMGGGEVHAHGDHRIAMAFSVASLRATAPIRILDCANVATSFPNFL
TLCAQVGIRVAQEAQL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcctggtggtggtcggtctggggttgattggcggctccttcgccaaaggc
ctgcgtgaaagcgggctatgtggcgaagtggtgggggtggacctcgacccgcaatcgcgc
acgttggcggtggagttgggggtggtggaccgctgtgaggcggacctggccgttgcgtgc
cagggcgcggatgtgatccagcttgccgtgccgatcctggccatggagaagttgctggcg
gtactggcgggcatggacctcgggcaagcgatccttaccgatgtgggtagcgccaaaggc
aacgtggtgcgcgcggcacgattggcgtttggtggcatgccgccgcgctttgtgccgggt
catcccatcgcgggttccgagcagagcggggtggaggcctccaatgcgcagttgtttcgt
cggcataaggtcatcctgacgccgcttgcgcaaaccgatcccacggcgttggcggtggtg
gatcgtctctggcgcgagctgggcgcggatgtggagcatatgcaggtcgagcgtcacgac
gaagtgttggcagccaccagccacttgccgcatctgctggcatttggcttggtggattct
ttggccaagcgcaacgagaacctcgagattttccgttacgccgccggcggcttccgcgat
tttacgcggattgccggcagcgatccggtgatgtggcacgacatcttcctcgccaatcgc
gaagcggtgttgcgcaccctggacaccttccgcagtgatctcgacgccttgcgcgacgcg
gtggatgcgggagacggccatcaactgctgggcgtgttcacccgggcacgggtggcgcgt
gaacatttcagcaagattctcgcacgccgggcctatatggaaaccgcagtgaacaccgat
gatctgaccttcatcgccagcccgggtggccgcttgagcgggcgcatccgcgtgccgggt
gacaagtcgatctcccatcgctcgatcatgctgggctcgttggccgagggtgtgaccgag
gtggaaggcttccttgagggtgaggacgccctggcgaccttgcaggcctttcgcgacatg
ggcgtggtgatcgagggcccgcaccatgggcgcgtgaccattcacggtgtcggcctgcag
ggcctgaaggcagcgccggggccgatctacgtgggcaattccggcacgtcgatgcgcctg
ttggccggtgtattggcggcgcagcgcttcgacagcgtgttgaccggcgatgcctcgctg
tccaagcgcccgatgaaccgcgtggccaagccgctgcgtgaaatgggtgcgatcatcgag
accgggccggacgggcgtccgccactgagcattcgtggcgggcaatcgctcaaaggcttg
aactatgtactgcccatggccagtgcccaggtgaaatcctgcctgttgttggcggggtta
tacgctgagggtaaaacctcggtgaccgagcccgcaccgacccgcgaccacaccgagcgc
atgctgcgcggctttggctacccggtggcggtgcagggcgcgacggcgtcgctggcgtcg
gggcatgggttgaccgctacgcgtattgaagtgccaggggatatttcgtcttcggcgttt
ttcctggtggcggcctcgattgccgaaggctccgagctgttgctggagcatgtcggtatc
aacccgacccgcaccggtgtgatcgacatcctgcggctgatgggggctgatatcaccctc
gaaaatcagcgtgaggtgggcggcgagccggttgcggatttacgtgtgcgtgctgccgcg
ctcaagggtatcgagattccagaggccctggtgccgttggcgattgatgagtttcccgtg
ctgtttattgccgcagcctgcgctcaggggcgtactgttttacgcggggccgaagagctg
cgcctcaaggagtccgatcgcatccaggtgatggccgacggtctgttggctctgggcgtg
aagtgtgaacccacgcctgatgggcttatcattgacggtggcccgatgggcggcggtgaa
gtgcatgcccatggcgatcatcggattgccatggcgttcagtgtggcttccctgcgggcg
acggcgcctattcgtatccttgactgcgccaatgttgctacgtcttttccgaactttctg
acactgtgtgcccaagtcggcatccgtgttgcccaagaggctcaattgtga

DBGET integrated database retrieval system