KEGG   Pseudomonas fluorescens A506: PflA506_1747Help
Entry
PflA506_1747      CDS       T02114                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PflA506_1747
Enzymes [BR:pfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PflA506_1747
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PflA506_1747
Lipid biosynthesis proteins [BR:pfc01004]
 Fatty acid synthase
  Component type
   PflA506_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1917116..1917721
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAGFGLDTRKGWVALLEQRLKQEGFDDKV
VNASISGDTSAGGLARLPAALATHKPDVVVIELGGNDGLRGQPPAQLQQNLASMIQQSRD
SGAKVLLLGMQIPPNYGKRYVEAFAKVFGDVAQKEKVPFVPFFLEGVGGHPELMQADGLH
PAVAAQDKLLENVWPALKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtttttgagtgctggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagtgccggtttcggcctggatacccgc
aaagggtgggtcgcgttgctggagcaacggctcaagcaggagggttttgacgacaaagtg
gtcaatgcttccatcagtggcgacaccagtgcaggaggcctcgcgcggctgcccgcggcg
cttgcaacgcacaaaccggacgtggtggtgatcgagttgggtggcaacgatggcttgcgc
ggccagccgcctgcgcaattgcaacaaaatcttgcttcgatgattcagcagtcccgggac
agcggcgccaaggtgctgctgttgggtatgcagattccgcccaattacggcaagcgctat
gtcgaagcttttgccaaggtattcggtgatgtggcacagaaagaaaaggtgccgtttgtg
ccgtttttcctcgagggcgtgggtggccatccggagttgatgcaagctgacgggctgcac
ccggcggtcgcggcgcaagacaagttgctggaaaatgtctggccggcgctaaaaccgctg
ctatga

DBGET integrated database retrieval system