KEGG   Pseudomonas fluorescens A506: PflA506_1747Help
Entry
PflA506_1747      CDS       T02114                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pfc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1917116..1917721
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAGFGLDTRKGWVALLEQRLKQEGFDDKV
VNASISGDTSAGGLARLPAALATHKPDVVVIELGGNDGLRGQPPAQLQQNLASMIQQSRD
SGAKVLLLGMQIPPNYGKRYVEAFAKVFGDVAQKEKVPFVPFFLEGVGGHPELMQADGLH
PAVAAQDKLLENVWPALKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtttttgagtgctggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagtgccggtttcggcctggatacccgc
aaagggtgggtcgcgttgctggagcaacggctcaagcaggagggttttgacgacaaagtg
gtcaatgcttccatcagtggcgacaccagtgcaggaggcctcgcgcggctgcccgcggcg
cttgcaacgcacaaaccggacgtggtggtgatcgagttgggtggcaacgatggcttgcgc
ggccagccgcctgcgcaattgcaacaaaatcttgcttcgatgattcagcagtcccgggac
agcggcgccaaggtgctgctgttgggtatgcagattccgcccaattacggcaagcgctat
gtcgaagcttttgccaaggtattcggtgatgtggcacagaaagaaaaggtgccgtttgtg
ccgtttttcctcgagggcgtgggtggccatccggagttgatgcaagctgacgggctgcac
ccggcggtcgcggcgcaagacaagttgctggaaaatgtctggccggcgctaaaaccgctg
ctatga

DBGET integrated database retrieval system