KEGG   Pseudomonas fluorescens A506: PflA506_1779Help
Entry
PflA506_1779      CDS       T02114                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00480  Glutathione metabolism
pfc00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PflA506_1779
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PflA506_1779
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PflA506_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AFJ55646
Position
1944669..1945154
Genome map
AA seq 161 aa AA seqDB search
MSDSLLSIPCTTIKGEQKTLADFAGKAILVVNTASKCGFTPQYKGLEQLWQQYKDQGLVV
LGFPCNQFGKQEPGNEGAISEFCELNFGVSFPLFKKIDVNGSDAHPLFVQLKKQAPGLLG
SKNIKWNFTKFLIGRDGQQVKRFAPTTKPQDLTQEIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactccctgctgagcatcccttgcaccaccataaagggtgaacaaaagaccttg
gccgattttgccggcaaggccattttggtggtcaacaccgccagcaaatgcggcttcacc
ccgcagtacaagggccttgagcagctttggcagcaatacaaggaccagggcctggtggtg
ctcggctttccctgcaaccagttcggcaagcaggaaccgggcaacgaaggcgcgatatcc
gagttctgcgagctgaatttcggcgtcagttttccgctgttcaagaaaatcgacgtcaat
ggcagcgatgcccacccgctgttcgtgcagttgaaaaaacaggccccgggactactgggt
tccaagaacatcaagtggaacttcaccaagttcctcatcggccgtgatggccagcaggtc
aagcgctttgcgccaaccaccaagccccaggacttgacccaggagatcgaagccctgctc
aaatga

DBGET integrated database retrieval system