KEGG   Pseudomonas fluorescens A506: PflA506_1842Help
Entry
PflA506_1842      CDS       T02114                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PflA506_1842 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PflA506_1842 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PflA506_1842 (sucB)
Enzymes [BR:pfc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PflA506_1842 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2015240..2016463
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPSFPESVADGTVATWHKKPGEAVKRDDLIVDIETDKVVLEVLAEADGVLGAIV
AEEGATVLSNQVLGSIEEGSAAAAAPAPAAAAPAASAPAAPAAGGEDPIAAPAARQLAEE
NGINLASIKGTGKDGRVTKEDVVAAVEAKKNAPAAAPAKAAAPAAAAPVFAAGDRTEKRV
PMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGGDIVYHGYSDIGVAVSSDRGLVVPVLRNAELMSLAEIEGG
IAGFGKKARDGKLTIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccgtcattcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaaaccaggcgaggccgtcaagcgtgacgacctgatcgtcgacatcgag
accgacaaagtcgttctggaagtgttggccgaagctgacggcgtgctgggcgcaatcgtt
gctgaagagggcgctaccgttctgtcgaaccaggtactgggctcgatcgaagagggcagc
gctgctgccgctgctcctgctcctgccgctgctgcaccggctgcttctgcgcctgccgca
ccggctgcgggtggcgaagatccaatcgctgcaccggctgcgcgtcaactggctgaggaa
aacggcatcaacctggcttccatcaagggcaccggcaaagatggccgtgtgaccaaggaa
gacgtggttgccgcagttgaagccaagaagaacgctccggctgccgcacctgccaaggct
gcagcgcctgctgctgctgcgcctgtgtttgccgctggcgaccgcaccgagaagcgcgta
ccgatgactcgtgtacgtgccaccgtggccaagcgcctggttgaagctcagtcgaacatg
gcgatgctgaccaccttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaag
tacaaggacctgtttgagaagtcccacaacggcgtgcgcctgggcttcatgtcgttcttc
gtgaaagcggccaccgaagcgctgaagcgcttcccggcagtcaacgcttcgatcgacggc
ggcgacatcgtttaccacggctactcggatatcggcgttgccgtctccagcgaccgcggc
ctggtggttccagtcctgcgtaacgccgagctgatgagcctggccgaaatcgaaggcggc
atcgctggcttcggcaagaaagcccgtgacggcaagctgaccatcgacgagatgaccggc
ggtaccttcaccatcaccaacggtggtaccttcggttcgatgatgtcgacgccgatcgtc
aacccaccgcaggccgcgatcctgggcatgcacaacatcatccagcgtccgatggccatc
aacggccaagtcgtgatccgcccaatgatgtacctggcactgtcttacgatcaccgcctg
atcgacggtaaagaagccgtgacgttcctggtgaccatcaagaacctgctggaagacccg
gctcgcctgctcctggacatctga

DBGET integrated database retrieval system