KEGG   Pseudomonas fluorescens A506: PflA506_1844Help
Entry
PflA506_1844      CDS       T02114                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00020  Citrate cycle (TCA cycle)
pfc00640  Propanoate metabolism
pfc00660  C5-Branched dibasic acid metabolism
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01130  Biosynthesis of antibiotics
pfc01200  Carbon metabolism
Module
pfc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PflA506_1844 (sucC)
   00640 Propanoate metabolism
    PflA506_1844 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PflA506_1844 (sucC)
Enzymes [BR:pfc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PflA506_1844 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AFJ57512
Position
2018204..2019370
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDTPEAAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAQQWLGKRLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHETPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVAQFAKI
FVGLAKLFQDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDP
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgaatacggcctgccagtttcc
aagggctacgcagtagacaccccggaagcagcagcagaagcttgcgacaaaatcggcggc
agcgagtgggttgtcaaagcccaggtccacgccggtggtcgcggtaaagcgggcggcgtc
aagctggttcgcagcaaagaagacgccaaggccttcgcacagcagtggctgggcaagcgt
ctggtgacttaccagactgatgccaatggccaaccagtcaccaagatcctggttgaatcg
tgcactgatatcgctaaagagctgtacctgggcgctgtcgttgaccgttcgagccgtcgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaaattgctcacgaaacc
ccagaaaaaattctgaaggccactatcgatccactggttggcgctcagccattccagggt
cgtgaactggctttccagctgggcctggaaggcaagcaagttgcccagttcgccaagatc
ttcgtaggtctggccaaactgttccaggatcacgatctggccctgctggaagtgaacccg
ctggtgatcaaggctgacggcgatctgcactgcctcgatgccaagatcaacatcgacgcc
aacgccatgtaccgtcagcctaagctgaagactttccacgatccgtcgcaagacgatccg
cgcgaagcgcacgctgccaagttcgaactgaactacgtagccctggaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcgtcaacctgcatggc
ggcaagccagccaacttcctcgacgtaggtggtggcgctaccaaggaacgcgttaccgaa
gcgttcaagatcatcctgtccgactccaacgtcgctgcagtactggtcaacatcttcggc
ggcatcgttcgttgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagtcggc
gttaaaatcccggttgttgttcgccttgaaggtaacaacgctgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcatcgcggctaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaagtaa

DBGET integrated database retrieval system