KEGG   Pseudomonas fluorescens A506: PflA506_2177Help
Entry
PflA506_2177      CDS       T02114                                 

Definition
methylesterase, CheB family/methyltransferase, CheR family/sensor histidine kinase/response regulator
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pfc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2348177..2352334)
Genome map
AA seq 1385 aa AA seqDB search
MKSAPPRSPNVPQRKDLTPSNLNFPVVGIGASAGGLQAVKAFFEHMPKDCGMAFVVVLHL
SPDHQSVADKIIQETTRMPVSQVNDATPIEKNHVYVISPAQLLKMNDGYLAVSPAVREGG
SHIAIDLFFRDLADTHKERAFCLILSGTGSDGAVGLSRIKEQGGITLVQAPEDAEYDGMP
LAAIETQMVDLVLPVVEMPQKLLELWRNAQSIVLPTANDPEIKTIPPSSERDAAVAEQLL
LDILIQLRASTGHDFKHYKRATVLRRIERRLQVTAQPDLATYYNFLQANPDETKALLGDM
LIGVTNFFRDREAFEALERDVIPNLVKSLEDSVPHREEVRIWSAGCSTGEEAYSLAMLVA
EQLALDASGAKMQVFATDIDERAITHGRNGVYPEAIITDVPPQRLRQYFAKEKNQHYRVR
KEIREKVLFAKHSLLADPPFSQIDLIVCRNLLIYLDREVQRDILQMFHFALRPGGYLFLG
SSESADGCLDLFVPVDKRNRIFRVRAGSSAVRRAPTMPRGGYLRPSATTLAIETKAPSKV
SFADIHLRALEKAAPPSVIVNMQADILHMSEGAGRFLRYVAGEVTHNLLTLVHPDLRLDI
RTTLFQVQQSNSPVSSRKIRIQREQGPFLVDISARPYRDEATENDYVLVIFQETAVDPLL
PDIDTVTQAENAIMSNLERELQRTKLHLQDTIEQAEVSSEELKASNEEMQAVNEELRSAT
EELETSKEELQSINEELLTVNFELKTKVEETDKVNDYLTNLIASTDIATVFVDRNMRIRW
FTPRATDIFSMLPVDTGRSLLDITHRLDYPQMTEDAATVFESLSMIEREISSNDDRWYIA
RLLPYRSSEDHIDGTVLTFIDITKRRQAEEELRLGEERMRLVAESTHDFAIIILDDHGAI
TDWNTGAELIFGYTKDEVLGAYYDLIFSPEDRTAGVPEKELRTAREHGRGEDERWHVRKD
GSRFYCSGEVTQLKSNSLRGYVKIARDLTGHKRTQDEQNQRLKETQTNSHLKDEFFAVMS
HELKHPLNLIQLNAELLRRLPATKVAGPAIKAVNTICEAVSSQARIIDDLLDVARVRTGK
LKLKKQPIDLIRTLKDIHSVVLADGHRRQVSLQTPSVPGPLIVDVDPTRIEQVIWNLVNN
ALKFTPEDGQVQLVVSRSDGRAQLDVIDSGAGLAQESLEEIFDLFGQAENQHQTHQREGL
GIGLSLVRQLVEAHGGSVSVHSRGLGFGCTFSIWLPLCEQQDHLLDSGATQNEDQRLNGL
KVLLVDDSAEVLEVLNMLLEMEGAQVSAFSDPLSALETARDAQYDVIISDIGMPKMNGHA
LMQKLRKVGHLRQAPAIALTGYGAGNDQKKATESGFNAHVSKPVGHDSLISLIEKLCRSR
RSGRG
NT seq 4158 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgcccccccgcggtcccccaacgttccgcaacgcaaagatctgacccccagt
aacttgaatttcccggtggtgggtatcggtgcctcggcgggcgggctgcaagccgtgaaa
gcgttcttcgagcacatgcccaaagactgcggcatggccttcgtggtggtcctgcatctt
tcgcccgaccatcaaagcgtggcagacaagatcatccaggaaacgacccgcatgccggtg
tcgcaggtcaatgacgccacgcccatcgaaaagaatcacgtgtacgtcatctccccggcg
cagctcttgaagatgaacgatggttacctggcggtctcgcctgccgtgcgcgaaggtgga
tcgcacattgccatcgacctgttttttcgcgacctggcagacacccataaagaacgcgcg
ttttgcctgatcctgtctggtaccggctcagacggcgcggtggggctgtcgcgcatcaaa
gagcaaggcggcatcaccctggtacaagcaccggaagacgccgagtacgatggcatgccg
ctggcggccatcgaaacccagatggtcgacctggtgctgccggtggtggaaatgccgcag
aagctgctggaactgtggcgcaatgcccagtcgattgtgctgcccaccgccaacgatcct
gagatcaagaccatcccacccagctccgaacgcgatgccgccgtggccgagcagctgttg
ctggatattctgatccagttgcgcgccagtaccgggcatgacttcaagcattacaaacgc
gccacggtgttgcgtcgtatcgagcggcgcttgcaggtcacggctcaacccgacctggcc
acctattacaacttcctccaggccaacccggacgaaaccaaggcgttgctgggcgacatg
ctgattggcgtgaccaacttcttccgcgaccgcgaggccttcgaagcccttgagcgggac
gtgatccccaacctggtgaagtcactggaagacagcgtgccgcaccgtgaggaggtgcgc
atctggtcggcgggttgctccaccggcgaagaggcctacagcctggcgatgctggtggcc
gagcaactggcgctggacgccagcggtgcaaagatgcaggtgtttgccaccgatattgat
gagcgggccattacccatggccgcaacggcgtgtaccccgaagcgatcatcaccgacgta
ccgcctcaacggttgcgccagtactttgccaaggagaagaaccagcactaccgggtgcgc
aaggaaattcgcgaaaaggtgctgttcgccaaacacagcctgttggccgacccaccgttc
tcgcagatcgacctgatcgtgtgccgcaacctgttgatctacctggaccgcgaagtgcaa
cgcgacatcctgcaaatgttccacttcgcgttgcgtcccggtggctacctgttcctcggc
tcctcggagtcggccgacggctgcctggacctgtttgtaccggtggacaagcgcaaccgc
attttcagggtgcgtgccggctcgtccgccgtgcgccgcgccccgaccatgccgcgaggc
ggctatctgcgcccgagcgccacgacgctggcgattgaaaccaaggcgcccagcaaggtc
tcgttcgcagacatccatctgcgcgccctggaaaaagccgcgccgcccagcgttatcgtg
aatatgcaggccgatatcctgcacatgagcgaaggcgcaggtcgattcctgcgctacgtg
gccggcgaggtgacgcacaacctgctgacgttggtgcatcccgatttacgcctcgatatc
cgcaccaccttgtttcaggtccagcaatcgaatagcccggtgtcttcgcgcaagatccgc
atccaacgcgagcaaggccccttcctggtggacatcagcgcccgcccctaccgcgatgaa
gcgaccgaaaacgactacgtgctggtgatcttccaggaaaccgccgtcgacccgttgctg
cccgacatcgacaccgtcacccaggccgaaaacgcgatcatgagcaacctggagcgcgag
ctgcaacgcaccaagttgcacctgcaggacaccatcgaacaggcggaagtctccagcgag
gaactcaaggcctccaacgaagaaatgcaggcggtcaacgaagaactgcgctcggccacc
gaggagttggaaaccagcaaggaagagttgcagtcgatcaacgaagaattgctgaccgtc
aatttcgagctcaagaccaaggtggaagagacggacaaggtcaacgattacctgaccaac
ctgatcgcgtccaccgacatcgccacggtcttcgtcgaccgcaacatgcgcattcgctgg
ttcacgccacgggccacggatattttcagcatgctgccggtagacaccgggcgctcgttg
ctggacatcacccaccgcctcgattacccgcaaatgaccgaagacgccgccaccgtgttt
gagtccctgagcatgatcgagcgggaaatcagcagcaacgacgaccgctggtacattgcg
cggttgctgccctaccgctccagcgaagatcacattgatggcaccgtgctgaccttcatt
gatatcaccaagcggcgtcaggccgaagaggaactgcgcctgggcgaggagcgcatgcgc
ctggtcgccgagagcacccatgactttgccatcatcatcctcgatgaccatggcgccatc
accgactggaacaccggtgccgaactgatcttcggctacaccaaggacgaggtgctgggc
gcttactacgatctgattttctccccggaagaccgcaccgctggcgtgccggagaaagaa
ctgcgcaccgcccgcgaacatgggcgtggcgaagatgaacgctggcatgtgcgcaaggac
ggcagccgcttctattgcagcggcgaggtcacccagctcaaaagcaatagtttgcgcggc
tacgtcaagattgcccgggaccttaccggccacaaacgcacccaggacgaacagaatcag
cgcttgaaggaaacccagaccaacagccatctcaaggatgagttcttcgcggtgatgtcc
cacgaactcaagcatccgttgaacctgatccagctgaacgccgaactgttgcggcgcttg
ccagccaccaaggtcgcgggcccggccatcaaggcggtcaataccatctgcgaagcggtg
tccagccaggcgcggatcattgacgacctgctggatgtcgcccgggttcgcacgggcaaa
ctgaagctgaaaaagcaaccgatcgacctgattcgcaccctcaaggacattcacagcgtg
gtccttgccgacggtcatcgtcgccaggtcagccttcagacaccttcggtgccgggcccg
ttgatcgttgacgtagaccccacgcgcatcgagcaagtgatctggaacctggtcaacaac
gccctgaaattcacccccgaagacggccaggtgcagttggtggtcagccgctcggacggg
cgcgcgcaactggacgtcatcgacagcggcgcgggcctggcccaagaaagcctggaagaa
atcttcgacctgttcgggcaagcggaaaaccagcaccagactcaccagcgcgaaggcctg
gggattggcttgtcgttggtgcggcagctggtggaggcccacggcggttcggtgagcgtg
cattcgcgagggttgggcttcggttgcaccttttcgatctggttgccgctgtgcgaacag
caggatcatctgctggatagcggcgctacccagaacgaagatcagcgcctcaatggcctc
aaggtgttactggtcgatgattcagccgaagtccttgaggtgctgaacatgctgctggaa
atggaaggcgcccaagtgagcgccttcagcgacccgttaagcgcacttgaaacagcccgg
gatgcccagtacgacgtgattatttcggacatcggcatgcctaaaatgaatggccatgcg
ctgatgcagaagctgcgtaaagtaggccaccttcgacaggctcccgccattgcattgacc
ggctacggcgcaggcaatgaccagaaaaaggcgactgaatcaggctttaatgcgcatgtc
agcaagcccgtgggccatgattcgttgatctccttgatcgaaaaactgtgccgctcacgc
cgttcgggtcggggctga

DBGET integrated database retrieval system