KEGG   Pseudomonas fluorescens A506: PflA506_2253Help
Entry
PflA506_2253      CDS       T02114                                 

Definition
aldose 1-epimerase family protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pfc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2432033..2433181)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLALSMLIASGGAHAAGLSSEHKPFGKTNDGTAVEQYVLRNSHGMQATVIT
YGGVLQSLKVPDKHGKLDDVVLGFDDVQGYQGGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKQVWQAKSVKDKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDHNELHIDYTATTDKPTVLNLTNHSYFNLAGAGNGDILKQVASLHASHYTPVNATLIP
TGELAPVKGTPMDFLKPTPIGQHIKADHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLYTTEPGVQFYTSNFLDGSVKGKGGKTYQHWSGFTLETQHFPDAPNQPSF
ASTRLNPGQTYTQHTIFKFTAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgatacctgctgtccggcctcgcgctgtccatgctgatcgccagcggt
ggcgcgcacgccgccggccttagcagcgaacacaaacccttcggcaaaaccaacgatggc
accgccgtcgaacagtacgtgttgcgcaacagccatggcatgcaagccacggtgatcacc
tacggcggcgtgctgcagtcgctaaaagtgccagacaaacacggcaagctcgacgacgtg
gtgctgggcttcgatgacgtgcaaggctatcaaggcggtaccgcgtttttcggcgcgacc
attggccgcttcggcaaccgcctggccggcggcgccttcgaactcgacggcaaacgctac
caggtaccgctcaacgacggccctaactcattgcatggcggcgcccagggcttcgacaag
caggtgtggcaagccaaatcggtcaaggacaaggattcggtgggcgtcaccctcacctac
ctgtccaaagatggggaaatgggctttccgggcaacttgaaaaccgaggtcacctaccgc
ctcaacgaccacaacgaactgcacatcgactacaccgccaccaccgacaaaccgacggtg
ctcaacctcaccaaccacagctacttcaacctggccggcgcgggcaacggcgacattctc
aagcaggtcgccagcttgcacgccagccactacacaccggtgaatgccaccttgattccc
accggcgaactggcgccggtcaagggcacgcccatggacttcctgaagcccacacccatc
ggccagcacatcaaggcagaccatccgcagctcaaattcgccgagcccaagcaaggtggc
ttcgacttcaactgggcgctggataccaaaggcgacgtcaagcaactggccgccgaggtg
catgatcctgaatcaggccgacgtttgcagctctacaccacagagcctggcgtgcagttc
tataccagcaacttcctggacggttcggtgaagggcaaaggcggcaagacgtaccagcac
tggagtgggtttaccttggagacccagcattttccggatgcgcctaaccagccgagcttt
gcctcaacgcgtttgaatccagggcagacttacacccaacacactattttcaagttcacc
gctgattaa

DBGET integrated database retrieval system