KEGG   Pseudomonas fluorescens A506: PflA506_2253Help
Entry
PflA506_2253      CDS       T02114                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00010  Glycolysis / Gluconeogenesis
pfc00052  Galactose metabolism
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PflA506_2253
   00052 Galactose metabolism
    PflA506_2253
Enzymes [BR:pfc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PflA506_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFJ59623
Position
complement(2432033..2433181)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLALSMLIASGGAHAAGLSSEHKPFGKTNDGTAVEQYVLRNSHGMQATVIT
YGGVLQSLKVPDKHGKLDDVVLGFDDVQGYQGGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKQVWQAKSVKDKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDHNELHIDYTATTDKPTVLNLTNHSYFNLAGAGNGDILKQVASLHASHYTPVNATLIP
TGELAPVKGTPMDFLKPTPIGQHIKADHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLYTTEPGVQFYTSNFLDGSVKGKGGKTYQHWSGFTLETQHFPDAPNQPSF
ASTRLNPGQTYTQHTIFKFTAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgatacctgctgtccggcctcgcgctgtccatgctgatcgccagcggt
ggcgcgcacgccgccggccttagcagcgaacacaaacccttcggcaaaaccaacgatggc
accgccgtcgaacagtacgtgttgcgcaacagccatggcatgcaagccacggtgatcacc
tacggcggcgtgctgcagtcgctaaaagtgccagacaaacacggcaagctcgacgacgtg
gtgctgggcttcgatgacgtgcaaggctatcaaggcggtaccgcgtttttcggcgcgacc
attggccgcttcggcaaccgcctggccggcggcgccttcgaactcgacggcaaacgctac
caggtaccgctcaacgacggccctaactcattgcatggcggcgcccagggcttcgacaag
caggtgtggcaagccaaatcggtcaaggacaaggattcggtgggcgtcaccctcacctac
ctgtccaaagatggggaaatgggctttccgggcaacttgaaaaccgaggtcacctaccgc
ctcaacgaccacaacgaactgcacatcgactacaccgccaccaccgacaaaccgacggtg
ctcaacctcaccaaccacagctacttcaacctggccggcgcgggcaacggcgacattctc
aagcaggtcgccagcttgcacgccagccactacacaccggtgaatgccaccttgattccc
accggcgaactggcgccggtcaagggcacgcccatggacttcctgaagcccacacccatc
ggccagcacatcaaggcagaccatccgcagctcaaattcgccgagcccaagcaaggtggc
ttcgacttcaactgggcgctggataccaaaggcgacgtcaagcaactggccgccgaggtg
catgatcctgaatcaggccgacgtttgcagctctacaccacagagcctggcgtgcagttc
tataccagcaacttcctggacggttcggtgaagggcaaaggcggcaagacgtaccagcac
tggagtgggtttaccttggagacccagcattttccggatgcgcctaaccagccgagcttt
gcctcaacgcgtttgaatccagggcagacttacacccaacacactattttcaagttcacc
gctgattaa

DBGET integrated database retrieval system