KEGG   Pseudomonas fluorescens A506: PflA506_2483Help
Entry
PflA506_2483      CDS       T02114                                 

Gene name
bchI
Definition
magnesium chelatase, subunit BchI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PflA506_2483 (bchI)
Enzymes [BR:pfc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PflA506_2483 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2716558..2717562
Genome map
AA seq 334 aa AA seqDB search
MTDTPHFPLSAVVGADDLKLALCLAAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGEGRAQFSPGVLAKADGGVLYVDEVNLLADHLVDLLLD
VAASGTNLIERDGISHRHAARFVLIGTMNPEEGELRPQLLDRFGFNVALSGQTLPSERGQ
IIRRRLDFDTDPAAFCAQWAPAQAALRERCTLARARLDSIALDDQALAHITERCFAAGVD
GLRADLVWLRGARAHAAWRGAVAIEQEDIDAVAEFALRHRRQQQAPAGAPPQPNDGPSSS
PSDTSPGQGQWGDMPAPALPTGARRDVPTWPKKP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactgatactccccatttcccgctgtccgccgtggtcggcgccgatgacttgaagctc
gcgctgtgcctggcggccatcgacccgaagatcggcggcgtgctgatcgaagggccacgg
ggtatggccaagtcgaccctggcccgtgggttggcggacctgctggccagcgggcagttt
gtcactttgcccctgggcgcaaccgaagagcgcctggtcggcaccctggacctggatgcc
gcgctgggcgaaggccgcgcgcaattctcccccggcgtgttggccaaggccgacggcggg
gtgttgtacgtggatgaagtcaacctgctggccgaccacttggtggacctgttgctggac
gtagccgccagcggcaccaacctgatcgaacgcgacgggatttctcatcgccatgcggcg
cgctttgtactgattggcaccatgaacccggaggagggcgagctgcgcccgcagttgctc
gaccgcttcggcttcaacgtggccttgagcgggcaaaccttgccctccgagcgcgggcag
atcattcggcgtcgcctggatttcgacactgacccggcggcgttctgcgcgcagtgggcg
ccagcgcaagctgccttgcgcgaacgctgcaccctggcgcgggcacggctagacagtatc
gccctggatgaccaggcgttggcccacatcaccgagcgctgctttgccgctggggtcgac
ggcctgcgtgccgacctggtctggttgcgtggcgcccgtgcccatgcggcgtggcgtggc
gctgtcgctatcgagcaggaagatatcgacgcggtggcggagttcgccttgcgccatcga
cgtcagcagcaagcgccggcaggcgcgccgccccagccgaatgacgggccgtcatcgtca
ccctctgacacctcgcccggccaaggccagtggggcgatatgcccgcacccgccttgccc
acgggcgcccgccgcgatgtacccacctggccaaaaaagccctag

DBGET integrated database retrieval system