KEGG   Pseudomonas fluorescens A506: PflA506_2695Help
Entry
PflA506_2695      CDS       T02114                                 

Gene name
fadB1x
Definition
enoyl-coa hydratase FadB1x (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PflA506_2695 (fadB1x)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PflA506_2695 (fadB1x)
   00650 Butanoate metabolism
    PflA506_2695 (fadB1x)
  Lipid metabolism
   00071 Fatty acid degradation
    PflA506_2695 (fadB1x)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PflA506_2695 (fadB1x)
   00310 Lysine degradation
    PflA506_2695 (fadB1x)
   00360 Phenylalanine metabolism
    PflA506_2695 (fadB1x)
   00380 Tryptophan metabolism
    PflA506_2695 (fadB1x)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PflA506_2695 (fadB1x)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PflA506_2695 (fadB1x)
   00281 Geraniol degradation
    PflA506_2695 (fadB1x)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PflA506_2695 (fadB1x)
   00627 Aminobenzoate degradation
    PflA506_2695 (fadB1x)
   00930 Caprolactam degradation
    PflA506_2695 (fadB1x)
Enzymes [BR:pfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PflA506_2695 (fadB1x)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2980016..2980789)
Genome map
AA seq 257 aa AA seqDB search
MSYETILLDVQGRVGLITLNRPNALNALNAQLVSELNQALDSLEANPEIGCIVLTGSKKA
FAAGADIKEMAELTYPQIYMDDLFSDSDRVANRRKPIIAAVNGFALGGGCELALMCDFIL
AGDTAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMEMCLTGRFIDAVEAERCGIVARIV
PADELLEEALKVAALIAGKSVPISMMVKESVNRAFEVSLSEGVRFERRVFHAAFATQDQK
EGMAAFVAKRAPQFKDK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgaaaccatcctgcttgacgtccagggccgtgtggggctgatcacgcttaac
cgccccaacgccctgaacgctttgaatgcacaactggtcagtgagctgaaccaggcgctg
gacagcctggaagccaaccctgaaattggctgcatcgtgctgactggctcgaaaaaagcc
ttcgcggccggtgccgacatcaaggaaatggccgagctgacctacccgcagatctacatg
gacgacttgttcagcgacagcgatcgcgtggccaatcgccgcaagccgatcatcgccgcc
gtgaatggcttcgccctgggcggtggctgcgaactggccctgatgtgtgactttatcctt
gccggcgacaccgccaagttcggccagccggaaatcaacctgggcgtgctgccaggcatg
ggcggcacccagcgcctgacccgtgcagtgggcaaggccaaggccatggagatgtgcttg
accgggcgttttatcgacgcggtagaggccgagcgctgcgggatcgtggcgcgcatcgtg
cccgccgatgaattgctggaagaagcgctgaaagtggccgccctgatcgccggtaaatcc
gtaccgatcagcatgatggtcaaggaaagcgtgaaccgtgcgtttgaagtcagcctgtcc
gaaggcgtgcgctttgagcgccgggtgttccatgcggcgttcgcgacccaggatcagaag
gaaggtatggccgcattcgtggccaagcgggcgccgcaattcaaggataagtaa

DBGET integrated database retrieval system