KEGG   Pseudomonas fluorescens A506: PflA506_2739Help
Entry
PflA506_2739      CDS       T02114                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PflA506_2739 (galU)
   00052 Galactose metabolism
    PflA506_2739 (galU)
   00500 Starch and sucrose metabolism
    PflA506_2739 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PflA506_2739 (galU)
Enzymes [BR:pfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PflA506_2739 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3032365..3033204)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTQMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYQKYRCTIVAVMEVNPTETNKYGVIAGDDIGD
GLIRVRDMVEKPAPEDAPSNLAIIGRYILTPDIFKLIEETEPGKGGEIQITDALLKQAKD
GCVIAYKFKGQRFDCGGAEGYIEATNFCYEHFYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggcactcgcttcttgccagcgacc
aaagccatgcccaaagaaatgctgccagtggtgaacaagccactgattcagtacggtgtg
gaagaggcactggatgccggtttgaacgagatctccatcgtcacgggtcgtggtaagcgc
gcgctggaagaccacttcgacatcagctatgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggtcggtatccgtaaactgctcgacgagtgctcgttctcctacacc
cgtcagactcagatgaaaggcctcggccacgccatcctcaccggccgcccgctgatcggt
gatgaacccttcgccgtggtcctggcggacgacctgtgcgtcaacctggaaggcgacggt
gtgctgacccagatggtcaagctctaccagaaataccgttgcaccatcgttgcggtaatg
gaagtcaacccaaccgaaaccaataagtacggtgttatcgccggcgacgatattggcgat
ggcctgatccgcgtacgcgacatggtcgagaaaccagcaccggaagacgcgccatcgaac
ctggcgattatcggtcgttacatcctcacgccggacatcttcaagctgatcgaagaaacc
gagccaggcaagggcggcgagatccagatcaccgacgctctgctcaagcaagccaaagat
ggttgcgtgattgcctacaagttcaagggccagcgtttcgactgcggcggcgctgagggc
tacatcgaagcgaccaacttctgctacgagcatttctacaagacgggcaaggcttactga

DBGET integrated database retrieval system