KEGG   Pseudomonas fluorescens A506: PflA506_3199Help
Entry
PflA506_3199      CDS       T02114                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pfc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3581176..3582501
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRAYSAADVVRLRGSVQPEHTFAKLGAEKLWNLVT
QGAKPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGTPTIILAR
TDANAADLLTSDCDPYDQPFVTGERTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagcccttgaaaaagactgggctgaaaaccca
cgctggaaaggcgtgacccgcgcttattccgctgctgacgtcgtccgcctgcgtggctcg
gtccaacctgagcacacctttgcaaaactcggcgccgagaagctgtggaacctggtcact
cagggtgccaagccttctttccgtcccgacaaagatttcgtcaactgcatgggcgccctc
actggcggccaggcagtccagcaggtaaaagccggtatccaggcgatctacctgtccggt
tggcaagtggcagcggacaacaactccgctgaatccatgtaccccgaccaatcgctgtac
ccggtggactcggtgccaaccgtggtcaagcgcatcaacaactcgttccgtcgtgccgac
cagatccagtggaaagccggcaagaacccaggcgatgaaggctacatcgactacttcgcg
ccaatcgtggcagacgccgaagccggtttcggtggcgtactcaacgcctacgagctgatg
aagagcatgatcgaggcaggcgctgccggcgtgcacttcgaagaccagctggcttcggtg
aaaaaatgcggccacatgggtggcaaggtactggtaccgacccaggaagctgtacagaag
ctgaccgccgctcgcctggccgctgacgttgccggtacaccgaccatcatcctggcccgt
accgacgccaacgcggcagacttgctgacctcggactgcgacccgtacgaccagccgttc
gtgactggcgaacgcacccaggaaggcttctataaagtgcgcgccggtctggaccaggcg
atcgcccgtggcctggcctacgcgccgtacgccgatctgatctggtgcgaaaccgccaag
ccagacctggacgaagcacgccgctttgccgaagcgatcaagaaggagtacccggaccaa
ctgctgtcctacaactgctcgccctccttcaactggaagaagaacctggacgacgcgacc
atcgccaagttccagcgtgagctgtcggccatgggctacaagcaccagttcatcaccctg
gccggtatccacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgcagacgccgccaaaggctac
accttcgtggcgcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacctcgtccgtgaccgcgctgaccggttcgaccgaagaagagcagttc
cactaa

DBGET integrated database retrieval system