KEGG   Pseudomonas fluorescens A506: PflA506_3465Help
Entry
PflA506_3465      CDS       T02114                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PflA506_3465 (rbsK)
Enzymes [BR:pfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PflA506_3465 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3869558..3870475)
Genome map
AA seq 305 aa AA seqDB search
MPAKVVVIGSLNMDLVTRASRLPRAGETLIGQTFSTVPGGKGANQAVASARLGASVAMVG
CIGTDAYGSQLRDALLVEGIDCQAVSTVDGSSGVALIVVDDSSQNAIVIVAGSNGELTPA
SLRTCDAVLQAADVIICQLEVPMETVGYALQRGRELGKTVILNPAPASGPLPADWYASID
YLIPNESEASALSGVTVDSLDSAKVAATALIQAGAGKVIITLGAQGALFADGQSFEHLVA
PKVKAVDTTAAGDTFVGGFAAALVAGQSEARAIRFGQVAAALSVTRAGAQPSIPTLHDVQ
GFVPA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtagtggtaataggcagcttgaacatggacctggtcactcgcgccagt
cgcttgccgcgtgccggtgaaaccctgatcggccagacgttctccactgtgcccggcggc
aagggcgccaaccaggccgtcgcctcggcacgcctgggggcgagtgtcgccatggtggga
tgcatcggtaccgacgcctatggcagccaattgcgcgatgcgctgttggtggaagggatc
gattgccaggccgtcagcacggtggacggctccagcggtgtggcattgatcgtggtcgat
gacagcagccagaacgccattgtcattgtggccggcagcaacggtgagctgacgcctgcg
tcgctgcgaacgtgcgacgctgtgctgcaggcggcagacgtgatcatctgccagcttgag
gtgccgatggagactgttgggtatgcgctccagcgggggcgcgaactgggcaagacggtc
attctcaacccggccccggcaagcgggccgttgcccgctgattggtatgcctcgatcgat
tatctgatccccaatgaaagcgaggccagcgctctgagtggcgtgacggtcgactccctc
gacagcgccaaggtcgccgcgaccgcgctgatccaggcgggcgccggtaaggtcatcatc
accctgggcgcccagggcgcgctgtttgccgacggccagagctttgagcacctggtggcg
ccgaaggtcaaggcggtggataccaccgctgctggcgatacctttgtcggtggctttgcc
gccgcgctggtcgcgggccagagcgaagcccgggcgatccgttttggccaggtggcggcg
gcattgtcagtgacccgcgccggcgctcagccttccattcctacgctgcacgacgtacaa
ggttttgtgcccgcatga

DBGET integrated database retrieval system