KEGG   Pseudomonas fluorescens A506: PflA506_3716Help
Entry
PflA506_3716      CDS       T02114                                 

Gene name
cheB
Definition
chemotaxis response regulator/protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pfc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4127594..4128724)
Genome map
AA seq 376 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQAIALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPDKVKQ
MLCEKVHSISRSNRRSLFSTPAPAPTPAPAAAAPSSSFARPAPAPVARPAVAPVRAAAAP
SAHSPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLVQHMPAAFTKAFAERL
DKLCRITVKEAEDGDILRPGLALLAPGGKQMMVDGRGAIKILPGDERLNYKPCVDITFGS
AAKSYGDKVLAVVLTGMGADGREGARLLKQGGSAIWAQDEASCVIYGMPMAIVKADLADA
VYSLDDIGKHLVEACL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggacgattcgggtttcttccgccgccgcgtctcggaa
attctttccgctgatccaacgatccaggtggtcggcacggccaccaacggcaaagaggcg
atcgatcaagccattgccttgaagccggacgtgatcaccatggactacgagatgccgatg
atggatggcatcacggccgtgcgccacatcatgcaacgctgccctacaccggtattgatg
ttttcctcgctgactcacgaaggcgcgcgggtgaccctcgacgctttggatgccggcgcg
gtggactttttgccgaagaatttcgaagacatctcgcgcaaccctgacaaggtcaagcag
atgctgtgcgagaaggtgcacagcatttcccgcagtaaccgtcgcagcctgttcagcaca
cctgcgccagcccctacgcctgcgcccgccgcagcggcgcccagttcgtcgtttgcgcgc
ccggccccggcgcccgtggcccggcctgcggtcgcgcccgtgcgtgccgccgcagcgccg
agtgcgcattcgccggcacccaagcgcaaggcttacaagctggtcgccatcggcacctcc
accggcggcccggtggccttgcagcgggtattgacccaactgccggccaacttccctgcg
ccgattgtgctggtgcagcacatgccggcggcattcaccaaggcgttcgccgagcgcttg
gacaagctgtgccgtatcaccgtcaaggaagccgaggatggcgacattctgcgtcctggc
ctggcactgctggcgccgggcggcaagcagatgatggtggatgggcgtggcgcgatcaaa
atcctgccgggcgatgagcgcctgaactacaagccgtgtgtggatatcaccttcggttcg
gcggccaagtcctatggcgacaaagttctggcggtggtgctcaccggcatgggcgccgat
ggccgtgaaggtgcgcgcctgctcaagcagggcggcagcgccatctgggcccaggatgaa
gccagttgcgtgatctatggcatgcccatggccatcgtcaaggctgacctggccgatgcg
gtctacagcctggacgacatcggcaagcacctggtggaggcctgcctctga

DBGET integrated database retrieval system