KEGG   Pseudomonas fluorescens A506: PflA506_4313Help
Entry
PflA506_4313      CDS       T02114                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00260  Glycine, serine and threonine metabolism
pfc00750  Vitamin B6 metabolism
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01230  Biosynthesis of amino acids
Module
pfc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PflA506_4313 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PflA506_4313 (thrC)
Enzymes [BR:pfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PflA506_4313 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFJ56795
Position
complement(4762511..4763920)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLATDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEETYGVFAHSAIAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLEKRGERVVIIGATSGDTGSAAIEGCKHCENVDIFILHPHKRVSEVQRRQMTTI
FGENIHNIAIEGNFDDCQEMVKNSFADQSFLKGTRLVAVNSINWARIMAQIVYYFHASLQ
LGGPARSVSFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDMHGRNGAALAELMNSFKQGGGFSVEQERWTETRKLFDS
LAVDDAQTCETIAQVYAETGEVLDPHTAIGVKAARECRRSLDIPMVILGTAHPVKFPEAV
EKAGIGKALELPEHLTDLFEREERCTVLANDLKTVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagcacccgcggccaggcaccggccctgaatttcgaagacgttctgctg
gcaggccttgccaccgacggcggcctgtatgtgcccgaaaacctgccacgcttcacccag
gaagaaatcgcctcctgggccggcctgccgtatcacgagctggctttccgagtgatgcgc
ccgttcgtcaccggcagcattccggatgcggattttaaaaagatcctggaagagacgtac
ggcgtgtttgcccatagcgccatcgcacctctgcgccagttgaacggcaacgagtgggta
ctggagctgttccacggcccgaccctggcgttcaaggactttgccctgcaactgctcggt
cgcctgctcgactacgtgctggaaaagcgcggcgagcgcgtggtgatcatcggcgccacc
tccggcgacaccggctcggcggccatcgaagggtgcaagcactgcgaaaacgtcgatatc
ttcatcctgcacccgcacaagcgcgtgtcggaggtgcaacgtcggcagatgaccaccatc
ttcggtgagaacattcacaacatcgccatcgaaggcaacttcgacgactgccaggaaatg
gtcaagaacagcttcgctgaccagagcttcctcaagggcacgcgtctggtggcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgcatcgctgcag
ttgggcggcccggcgcgttcggtgtcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggttacctggcacgcaacatgggcctgccgatcaaccagttgatcgtcgccacc
aaccgcaacgacatcctgcatcgcttcatgagcggcaaccagtatgtgaaggaaaccctg
cacgccacgctgtcgccgtccatggacatcatggtctcgtcgaacttcgaacgcttgctg
ttcgacatgcacggtcgcaacggcgcagccctggccgagttgatgaacagcttcaagcaa
ggtggcggtttcagcgtcgagcaagagcgctggaccgaaacccgcaagctgttcgattcc
ctggccgtggacgatgcgcagacctgcgaaaccatcgcgcaggtctatgccgaaaccggc
gaagtgctcgacccgcacacggctatcggcgtgaaagccgcccgcgaatgccgccgcagc
ctggatattccaatggtgatcctcggtaccgcgcacccggtcaagttcccggaagcggtc
gagaaagccggcattggcaaggccctggagttgccggagcatttgaccgacctgttcgag
cgcgaagagcgctgcaccgtattggccaatgacctgaagacagtgcaggcgtttgtcagc
cagcatggcaatcggggcaaaccgctctaa

DBGET integrated database retrieval system