KEGG   Pseudomonas fluorescens A506: PflA506_4315Help
Entry
PflA506_4315      CDS       T02114                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pfc  Pseudomonas fluorescens A506
Brite
Enzymes [BR:pfc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PflA506_4315 (dsbC)
Secretion system [BR:pfc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PflA506_4315 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4765421..4766152)
Genome map
AA seq 243 aa AA seqDB search
MRLTQIIAAAAIALVSTFAVADDAAEQTIRKSLANLALDTPIESISASPMAGLYEVKLKG
SRVLYASADGQYIVQGYLFQLKDGKPVNLTEKAERLGVSKLINGIPVAETVVYPAIGETK
THITVFTDTTCPYCHKLHAEIPALNKLGVEVRYVAFPRQGLGSPGDEQLQAVWCSADKKA
AMDKMVDGKEIKSAKCANPVSKQFALGQSIGVNGTPAIVLADGQVIPGYQPAPQVAKLAL
GAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgacccagattattgccgccgcagccattgcgttggtttccacctttgcggtc
gccgatgatgcggccgagcagaccattcgcaagagcctggccaacctggcgctcgatacc
ccgatcgaaagcatcagcgccagccccatggccggcctgtatgaagtcaagctcaagggc
agccgtgtgctgtacgccagtgccgatggccagtacatcgtccagggctacctgttccag
ctcaaggacggcaagccggtcaacctgaccgagaaggccgagcgcctgggtgtgtccaag
ctgatcaacggtatcccggtggctgaaaccgtggtgtacccggccatcggcgagaccaag
acccacatcaccgtgttcaccgacaccacctgcccgtactgccacaagctgcacgctgaa
atcccggcactgaacaagctgggcgtggaagtgcgctacgtcgcgttcccgcgccagggc
ctgggttcgccgggtgacgagcagttgcaagccgtatggtgttcggccgacaaaaaggcg
gccatggacaagatggtcgacggcaaggaaatcaaatcggccaaatgcgccaacccggtt
tccaagcagttcgccctgggccagtccattggtgtgaacggtacaccggccatcgttttg
gccgacggccaggtgattccgggctaccagccggcgccgcaagttgccaaactggcactg
ggtgccaagtaa

DBGET integrated database retrieval system