KEGG   Pseudomonas fluorescens A506: PflA506_4407Help
Entry
PflA506_4407      CDS       T02114                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pfc00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4858591..4858965)
Genome map
AA seq 124 aa AA seqDB search
MKYVLLTLILTVIAAPALAAGDADAGGKLFTKTCGGCHSIGEGARGGFGPELNGIIGRPA
GTTTDYQYSDAMKNSGVVWTREKLAAYIEDPKSVVSGTRMIFWGISDQEKIENILAYLET
FQPK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtgttattgaccctcatcctgaccgttatcgccgcacccgcgctcgctgcg
ggcgacgccgacgcgggcggcaaactcttcaccaagacctgcggtggctgccacagcatt
ggtgaaggcgcgcggggtggttttggcccggaactgaacggcatcattggccggcctgcc
ggtactaccacggactatcagtattcggatgcgatgaagaactcaggcgtggtgtggaca
cgggaaaaactggcggcctacattgaagatccgaagtcggtggtgagtggcacgcggatg
atcttctgggggatcagtgaccaggagaagattgaaaatatcctggcgtatctggagaca
ttccagcccaagtga

DBGET integrated database retrieval system