KEGG   Pseudomonas fluorescens A506: PflA506_4449Help
Entry
PflA506_4449      CDS       T02114                                 

Definition
(RefSeq) short chain dehydrogenase/reductase family protein
  KO
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PflA506_4449
   00670 One carbon pool by folate
    PflA506_4449
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PflA506_4449
    1.5.1.-  
     PflA506_4449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4903913..4904623
Genome map
AA seq 236 aa AA seqDB search
MNATNAPILITGAGQRVGLHCAERLLDEGQAVIFSYRSERPGVQALRERGAIGVFADFSS
EAGVLAFIGAVKTHTQSLRAIIHNASAWVAETPGDESRAFIDMFSVHMLAPYLINLHCSP
LLQRSTPADIVHISDDVVRKGSRQHIAYGATKAGLDSLTLSFAAQFAPLIKVNGIAPAMV
MFNEGDDAAYRAKVLAKSALGIEPGPEVIYQSVRYLLDNPYVTGTTLTVNGGRHIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaccaacgctccgatcctgatcaccggtgccggccagcgtgtcggcctgcat
tgcgccgagcgcctgttggatgaaggccaagccgtgattttcagctaccgcagcgaacgc
cccggcgtgcaggcgctgcgtgagcgcggtgccatcggcgtgtttgccgatttctccagc
gaagccggagtgctggctttcattggcgcagtgaaaacccatactcaaagcctgcgagca
atcatccacaacgcttcagcctgggtcgccgaaaccccgggcgacgaaagccgtgccttt
atcgacatgttcagcgtgcacatgcttgcgccgtacctgatcaacctgcattgttcacct
ttgctgcaacgctcgacacccgccgatatcgtgcatatcagcgacgacgtggtgcgcaag
ggcagccggcagcacatcgcctatggcgccaccaaggccgggctggacagcctcacgtta
tcgtttgccgcacagttcgcgccgctgatcaaggtcaacggcatcgcaccggcgatggtg
atgttcaacgaaggcgatgacgcggcctatcgcgccaaagtcctggccaagtcggccctg
ggcatcgagcccggacccgaggtgatctaccagagcgtgcgttacctgctggacaatccc
tatgtcaccggtaccaccctgaccgtcaacggcgggcggcatatcaagtaa

DBGET integrated database retrieval system