KEGG   Pseudomonas fluorescens A506: PflA506_4450Help
Entry
PflA506_4450      CDS       T02114                                 

Gene name
folE1
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00790  Folate biosynthesis
pfc01100  Metabolic pathways
Module
pfc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PflA506_4450 (folE1)
Enzymes [BR:pfc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PflA506_4450 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int QueF DUF3638 PHY
Motif
Other DBs
NCBI-ProteinID: AFJ57098
Position
4904644..4905204
Genome map
AA seq 186 aa AA seqDB search
MTLSLPHHYREILKGLGEDPQREGLLDTPKRAAKAMQYLCHGYEQNLEEIVNGALFASDN
DEMVILKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKLARIVDMFARRLQIQENLT
RQIADAIQDVTQAAGVAVVIEAKHMCMMMRGVEKQNSTMNTSVMLGAFRESNTTRMEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatccctgccccaccactaccgcgagatcctcaagggcctgggcgaagacccg
cagcgcgagggcctgctcgacacgcccaagcgtgccgccaaggccatgcagtacctgtgt
catggctatgagcagaacctggaagaaatcgtcaacggcgcactgttcgcgtccgacaat
gacgagatggtgatcctcaaggacatcgagttgtattcgttgtgcgagcatcacctgctg
cccttcatcggcaaggcccatgtggcctatattccgaccggcaaggtgctgggcctgtca
aaactggcgcgcattgtcgacatgttcgcccggcgcctgcagatccaggaaaacctcacg
cggcaaatcgccgacgccatccaggacgtgacccaggccgccggcgtggcggtggtgatc
gaagccaagcacatgtgcatgatgatgcgcggcgtggagaaacagaattcaaccatgaac
acctcggtgatgctcggcgcctttcgcgagtcgaacaccacccgcatggagttcctgcaa
ctgattggacggagcaagtag

DBGET integrated database retrieval system