KEGG   Pseudomonas fluorescens A506: PflA506_4533Help
Entry
PflA506_4533      CDS       T02114                                 

Gene name
folK_1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4993802..4994287
Genome map
AA seq 161 aa AA seqDB search
MERIYIGMGSNLAAPEQQLRSAIEALAQLPGTQLAGVSAFYQSDSLLPGQPPYTNAVAAL
DSHLAPLDLLDALQAIENDQGRERLERWGPRTLDLDILLFGDRLIDEPRLKVPHYQMHLR
AFVLYPLAELAPADLQLPDGQRLSHLLTACPFVGLERLPQE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgtatctacatcggcatgggcagcaacctggctgccccggagcaacaattgcgc
agcgcgatcgaggcgctggcgcaattgcctggcactcagctcgccggtgtgtccgccttc
tatcaaagcgattcactgctgcccggccagccgccctacaccaacgccgttgcggcgctg
gacagtcacctggcgccattggacctgctcgatgcgctgcaagccatcgaaaacgatcag
ggccgcgaacgcctggaacgctggggcccgcgcaccttggacctggatatcctgctgttc
ggtgatcgcctgatcgatgagccgcgcctcaaggtgccgcactaccagatgcatctgcgc
gcgtttgtactgtatccgttggctgagttggcgccagccgacctgcagctgcctgacggc
cagcgtttaagccacctgctcaccgcctgcccgttcgtcggcctggaacgcctccctcaa
gaatga

DBGET integrated database retrieval system