KEGG   Pseudomonas fluorescens A506: PflA506_4592Help
Entry
PflA506_4592      CDS       T02114                                 

Definition
(GenBank) ROK family protein
Organism
pfc  Pseudomonas fluorescens A506
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5067283..5068281
Genome map
AA seq 332 aa AA seqDB search
MILVFDVGGTSLRIGCYCEKQRRLVKQARIATPNFVNSPLRDRDLVEQLFRTMKDAAHTL
GVAYDTVVAALPGPVTAEGYVTALPTVLGAKLDRPIPAVAQLQALFDTQNVHVLNDITAA
GYRYLTPQHHTFHIVSSGSGIGSKLFIDGKPLTGHQGDAGEIGHLLHPLCPKELRCDCGG
EGHIGAVSSGRGTLRLFKLRASQQPTAYLNSALGKTTPTYDLLQTSSLVDAFQQRDPWTL
EVMDDAIRPLAHALAATRAVSGVASYILLGGFLCALGEPYRKRLAGLCTSFFDAGDWNDT
IALGHADDNNGLIGCALYAQGLLRHEHESQPL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgattttggtatttgatgtcggcggcaccagcctgcgcatcggctgttactgtgaaaag
cagcgccggctagtcaagcaggcccgcatcgccacgcctaacttcgtcaattcgccgttg
cgcgacagggacctggtcgaacagctgttcaggaccatgaaagacgctgcgcacaccctg
ggtgtggcgtatgacaccgtcgtcgccgcgcttcccggcccggtcaccgcagagggctat
gtcactgctctgcccactgtcctgggtgcaaaactcgacagacctataccggcggtggcg
cagttacaggcactctttgacacgcaaaacgtgcatgtactcaacgatataacggccgcg
ggataccgttacctgaccccgcagcatcacacgttccatatcgtgtcgtcgggatcgggg
atcggttccaagctgtttattgatggcaaacctttgaccggccatcaaggcgacgctggc
gaaattgggcacctgctccacccgctctgcccaaaggagttgcggtgcgattgcggtgga
gagggacacatcggtgccgtcagctcagggcgcggaaccctgaggctcttcaagttgcgc
gccagccagcaaccgaccgcatatctgaacagcgcattgggcaagaccacacccacatac
gacttgctccaaacctcctcactggttgacgccttccagcagcgagacccctggacgctt
gaggtcatggatgacgccatccgccctctcgcccacgcactggcggctactcgcgccgtc
tctggggttgcctcctacattttgctcggcggctttttgtgtgcgctgggcgagccttat
cgaaagcgattggctggcctttgcaccagcttcttcgacgctggagattggaacgacacc
atcgccctcggccatgccgatgacaacaatggcctcattggctgcgcgctctatgcacaa
ggactcctccgccatgaacatgaaagtcaaccgctataa

DBGET integrated database retrieval system