KEGG   Pseudomonas fluorescens A506: PflA506_4592Help
Entry
PflA506_4592      CDS       T02114                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PflA506_4592
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PflA506_4592
   00052 Galactose metabolism
    PflA506_4592
   00500 Starch and sucrose metabolism
    PflA506_4592
   00520 Amino sugar and nucleotide sugar metabolism
    PflA506_4592
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PflA506_4592
   00524 Butirosin and neomycin biosynthesis
    PflA506_4592
Enzymes [BR:pfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PflA506_4592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5067283..5068281
Genome map
AA seq 332 aa AA seqDB search
MILVFDVGGTSLRIGCYCEKQRRLVKQARIATPNFVNSPLRDRDLVEQLFRTMKDAAHTL
GVAYDTVVAALPGPVTAEGYVTALPTVLGAKLDRPIPAVAQLQALFDTQNVHVLNDITAA
GYRYLTPQHHTFHIVSSGSGIGSKLFIDGKPLTGHQGDAGEIGHLLHPLCPKELRCDCGG
EGHIGAVSSGRGTLRLFKLRASQQPTAYLNSALGKTTPTYDLLQTSSLVDAFQQRDPWTL
EVMDDAIRPLAHALAATRAVSGVASYILLGGFLCALGEPYRKRLAGLCTSFFDAGDWNDT
IALGHADDNNGLIGCALYAQGLLRHEHESQPL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgattttggtatttgatgtcggcggcaccagcctgcgcatcggctgttactgtgaaaag
cagcgccggctagtcaagcaggcccgcatcgccacgcctaacttcgtcaattcgccgttg
cgcgacagggacctggtcgaacagctgttcaggaccatgaaagacgctgcgcacaccctg
ggtgtggcgtatgacaccgtcgtcgccgcgcttcccggcccggtcaccgcagagggctat
gtcactgctctgcccactgtcctgggtgcaaaactcgacagacctataccggcggtggcg
cagttacaggcactctttgacacgcaaaacgtgcatgtactcaacgatataacggccgcg
ggataccgttacctgaccccgcagcatcacacgttccatatcgtgtcgtcgggatcgggg
atcggttccaagctgtttattgatggcaaacctttgaccggccatcaaggcgacgctggc
gaaattgggcacctgctccacccgctctgcccaaaggagttgcggtgcgattgcggtgga
gagggacacatcggtgccgtcagctcagggcgcggaaccctgaggctcttcaagttgcgc
gccagccagcaaccgaccgcatatctgaacagcgcattgggcaagaccacacccacatac
gacttgctccaaacctcctcactggttgacgccttccagcagcgagacccctggacgctt
gaggtcatggatgacgccatccgccctctcgcccacgcactggcggctactcgcgccgtc
tctggggttgcctcctacattttgctcggcggctttttgtgtgcgctgggcgagccttat
cgaaagcgattggctggcctttgcaccagcttcttcgacgctggagattggaacgacacc
atcgccctcggccatgccgatgacaacaatggcctcattggctgcgcgctctatgcacaa
ggactcctccgccatgaacatgaaagtcaaccgctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system