KEGG   Pseudomonas fluorescens A506: PflA506_4863Help
Entry
PflA506_4863      CDS       T02114                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01130  Biosynthesis of antibiotics
pfc01230  Biosynthesis of amino acids
Module
pfc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PflA506_4863 (trpC)
Enzymes [BR:pfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PflA506_4863 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFJ55261
Position
complement(5335660..5336496)
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLEKILARKAEEVAERRARVGLAELEAQAKSADAPRGFANALIAQAKLKQPAVIA
EVKKASPSKGVIRENFVPAEIAASYEKGGATCLSVLTDIDYFQGSDLFLQQARAACKLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAAVAKSVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFDVSLETTLDLLPRIPRDRLVITESGIVNRADVELMEISG
VYSFLVGETFMRAENPGAELQRLFFPERGTTISGSTLD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccaaccgttctggaaaagatcctggcccgcaaggctgaagaagtggccgag
cgccgcgcccgcgtgggcctggccgagttggaagcccaggcgaaaagcgccgatgcgcca
cgcggctttgccaatgccttgatcgcccaggccaagctcaagcagccggccgtgatcgcc
gaggtcaagaaagcctcgccgagcaagggggtgattcgcgagaactttgtacccgccgag
atcgccgccagttatgagaagggtggggcgacttgcctgtccgtactgacggatatcgac
tacttccaaggttcagacctgtttctgcaacaggcgcgcgccgcgtgcaagttgccggtg
atccgcaaggatttcatggtggacccgtaccagatcgttgaagcccgagccttgggtgcc
gactgcgtgttgctgattgtctccgcattggatgacgtgaagatggccgagctggcggcc
gtggccaaaagcgtcggcctggacgtgctggtcgaagtacacgacggcgacgagctggag
cgcgcattgaagaccctcgatactccgctggtgggcgtcaacaaccgtaacctgcatacc
ttcgacgtcagcctcgaaaccaccctcgacctgctgccgcgtatcccgcgcgatcgtctg
gtgattaccgagagtggcatcgtcaaccgcgccgatgtggaactgatggaaatcagtggc
gtgtactcgttcctggtgggcgagacgtttatgcgcgcagagaacccgggggcggagctg
cagcgcttgttcttcccggagcgcggtacgacgatcagcggttcgacactagactga

DBGET integrated database retrieval system