KEGG   Pseudomonas fluorescens A506: PflA506_5218Help
Entry
PflA506_5218      CDS       T02114                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase (EC:4.2.1.75)
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PflA506_5218 (hemD)
Enzymes [BR:pfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PflA506_5218 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5715367..5716125)
Genome map
AA seq 252 aa AA seqDB search
MTDWRVLLTRPAEESTALAALLAQSGIHSNCLPLLETEALPVTAEQHAVFGALPRYRAVI
VVSKPAARLALLRLGGSVPPMPWFSVGAATAQILADHGLNVHFPATGDDSEALLELPALR
EAIAAPGARVLILRGEGGRELLAERLREQGASVDYLELYRRFLPVYEKGALMQRIQLERL
NGLVVSSGQGFLHLHALAGPDWPEVAQLPLFVPSPRVYEMARAAGAEKVVDCRGASAAAL
LVALGSYPVPTL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgactggcgagtgctgctgacgcggcctgccgaggagtcgacggccctggcggcg
ttattagcccagagcggtattcacagcaactgcctgcctttgctggagactgaagccttg
ccggtgaccgcagagcaacacgcggtgttcggcgcgctgccgcgctatcgcgccgtcatc
gtggtgagcaagccggctgcgcgcctggcgttgctgcggttggggggcagtgtgccgcca
atgccctggttcagtgtcggcgcggccacggcccagatattggccgatcatggcctcaac
gttcactttcccgccacgggcgatgacagcgaggccttgcttgaactgcccgccttgcgc
gaggctattgcagcgccgggtgcccgggtgttgatcctgcgcggcgagggcgggcgtgag
ttgctggcagagcgtttacgcgagcaaggtgctagtgtcgattacctggaattgtatcgg
cgttttcttccggtgtatgagaagggcgcgttgatgcaacgcatccagttggaacgcttg
aacggcctggtggtcagcagtgggcagggttttttacacctgcacgcgttagccggcccc
gattggccagaggtggcacagctgccgttgttcgtgcccagcccgcgtgtatatgaaatg
gcgcgggccgcgggtgcagaaaaagttgtggattgtcgcggcgcgagtgccgcggctttg
ttagtggcgttagggagctatcccgttcccactctctga

DBGET integrated database retrieval system