KEGG   Pseudomonas fluorescens A506: PflA506_5268Help
Entry
PflA506_5268      CDS       T02114                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PflA506_5268 (algC)
   00030 Pentose phosphate pathway
    PflA506_5268 (algC)
   00051 Fructose and mannose metabolism
    PflA506_5268 (algC)
   00052 Galactose metabolism
    PflA506_5268 (algC)
   00500 Starch and sucrose metabolism
    PflA506_5268 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PflA506_5268 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PflA506_5268 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PflA506_5268 (algC)
Enzymes [BR:pfc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PflA506_5268 (algC)
    5.4.2.8  phosphomannomutase
     PflA506_5268 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5765906..5767303
Genome map
AA seq 465 aa AA seqDB search
MSTAARVAPTFPDSIFRAYDIRGVVPKTLTAETAYWIGRAIGSQSLAQGEPNVSVGRDGR
LSGPELVEQLIQGLADSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFK
IVIAGDTLANEQIQALHTRLKTNDLTRGTGTITKVDILQRYSDEITRDVKLARRLKVVVD
CGNGAAGVIAPQLLEALNCEVIPLFCEVDGNFPNHHPDPGKPENLVDLIAKVKETGADVG
LAFDGDGDRVGVVTETGEIVFPDRLLMLFARDVVARNANAEIIFDVKCTRRLTPLIKEYG
GRPLMWKTGHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFQTFPNDISTPEINIHVTEESKFSIIDALHDAQWGEGANLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADTEAELQRIKDVFHAQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcagcccgcgtagccccgacctttcccgacagcatttttcgcgcctatgac
atccgtggtgtggtccccaagaccctgaccgccgaaaccgcctactggatcggccgcgcc
atcggctcccagagtctggcccaaggcgaacccaacgtttcggtaggccgtgacggccgc
ttgtctggcccggagctggtcgagcaactgatccagggcctggctgacagcggctgccac
gtcagcgacgtcggtctggtgccaacccccgcgctgtactacgccgccaacgtactggcg
ggcaaatccggggtcatgcttaccggcagccacaacccgtcggactacaacggcttcaag
atcgtcatcgctggcgacaccctggccaatgagcagatccaggccctgcacacccgcctg
aagaccaacgacctgacccgcggcacagggaccatcaccaaggttgacatcctgcaacgc
tactccgatgaaatcacccgtgacgtcaagctcgcccgccgcttgaaagtcgtggtggac
tgcggcaacggcgcagcgggtgtgattgccccgcaattgctcgaagccctgaactgcgaa
gtgatcccactgttctgcgaagtggacggcaacttccccaaccatcacccagacccgggc
aaaccggaaaacctggtggacctgattgccaaggtcaaggaaacaggcgccgacgtcggc
ctggcgttcgatggcgacggcgaccgtgtgggcgtggtgaccgaaaccggcgagatcgtg
ttcccggaccgcctgttgatgctgtttgcccgcgacgtggttgcgcgcaatgccaacgcc
gagatcatcttcgacgtgaaatgcacgcgtcgcctgacgccattgatcaaggagtacggc
ggtcgcccgctaatgtggaagaccggtcactcgttgatcaaaaagaaaatgaaggaaacc
ggcgcgctgttggccggtgaaatgagcggccacgtgttcttcaaggagcgctggttcggg
tttgacgatggtatttacagcgccgctcgcctgctggagatcctcagcaaggaaaaatcc
acggccgaagagctgtttcagaccttcccgaatgatatttctacgccagagatcaatatc
catgtgaccgaggagagcaaattcagcatcattgacgcattgcacgatgcgcaatggggt
gaaggcgccaacctgaccaccattgatggtgtgcgagtcgattacgccaaaggctggggc
ctggttcgcgcgtccaacaccacaccggtgctggtcctgcgtttcgaggcggataccgag
gctgagttgcagcgcatcaaggacgtgttccacgcccagttgaaacgtgttgcccctgat
ctccaattaccgttctga

DBGET integrated database retrieval system