KEGG   Pseudomonas fluorescens A506: PflA506_5332Help
Entry
PflA506_5332      CDS       T02114                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00010  Glycolysis / Gluconeogenesis
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PflA506_5332
Enzymes [BR:pfc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PflA506_5332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFJ56717
Position
5841260..5842159
Genome map
AA seq 299 aa AA seqDB search
MPTPHVETVKIDELDCWRIRHNGAELMVAQQGAQIFSYQREGEQPLIWPNPEAVFKQGKG
IRTGVPVCWPWFGVFDRNPQSVKAMRQSNQPAGAHGFVRTARWELATTELDGQTLRVDLV
LPVPAGGFPGWPHQVDLTLSLLLDDQLHIRLTSHNRGADIVTLSQALHTYFAVSDVRKVQ
VEGLDGVAYIDTADGWAEKQQAGLLHFSAETDRIYLNTPAQLNIVDSDWQRRIQLTSEGS
KSTVVWNPWTERAKAFDDMADDGWQGMLCIETANVLDDVVNLAPGESHTLGVSITAQAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgccccacgttgagacggtaaaaatcgacgagctggactgctggcgcatccgc
cacaacggcgccgagttgatggtggcccaacagggtgcgcaaatcttcagttaccagcgc
gagggcgaacagccgctgatctggccgaaccctgaggccgtgttcaagcagggcaaaggc
attcgtactggcgtaccggtgtgctggccgtggttcggggtgttcgaccgcaacccgcaa
agtgtcaaagccatgcgccagagtaatcagcctgccggcgcccacggttttgtgcgcacc
gcccgctgggaattggccaccaccgaactcgacggccagacgctgcgagtggacctggtt
ttgccggtgccggctggcggctttccaggctggccccatcaggtagacctgacgctgagc
ctgctgttggatgaccaactgcacatccgcctgaccagccacaaccgcggcgccgacatc
gtgaccctcagccaggcattgcacacctacttcgccgtgagcgatgtgcgcaaggttcag
gtcgagggcctggatggcgtggcctacatcgataccgccgacgggtgggccgagaaacag
caagccgggctgctgcacttcagcgccgaaacagaccgcatttacctgaatacgccggca
cagctgaatatcgtcgatagcgattggcagcgccgtatccagctcaccagcgaaggctcg
aaatccaccgtggtctggaacccctggaccgaacgcgccaaggctttcgacgatatggcc
gatgacggctggcagggtatgttgtgcatcgagacggccaacgtgctggacgatgtggtg
aacctggcgcccggggaaagccacaccttgggcgtgagcatcacggcccaggccttgtaa

DBGET integrated database retrieval system