KEGG   Plasmodium falciparum Dd2: PFDG_00281Help
Entry
PFDG_00281        CDS       T01051                                 

Definition
3-hydroxyisobutyryl-coenzyme A hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Valine, leucine and isoleucine degradation
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFDG_00281
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PFDG_00281
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFDG_00281
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFDG_00281
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PFDG_00281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 292 aa AA seqDB search
MLKFNCIPYKNIGTFHDALKQHNIKFEKRNNFIFFHAFSSLRKYKSQHSEKNNILNKLFF
FKKEYKSYFHKLSNNLFLSSKRKNEVIFHKMDKTNKNVQMIKHNIITSQRRENGMEQYTA
IDGKTKVNNNNNNDNSNNNNDNSNNNKNNNNDMKANIHQDMDKVKNNMIDLELSELWTKK
SLIVNFQNNICEIILNRPEKLNAINKDMINALLNIIKSLDNDERCFMVIIRSTNSNCFSS
GSDVKYVVENKEQGIQHLKQLYLYINYISQMKKNLLCIWNGYVMGGGLGISI
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtttaattgcataccttataaaaatataggaacctttcatgatgcccttaag
cagcataatataaaatttgaaaaaagaaacaattttattttttttcatgctttttcatct
ttacgtaaatataaatcacaacattctgaaaagaataatattttgaataaattatttttt
tttaaaaaagaatacaaaagttacttccacaaactttccaataatttgttcttgtctagt
aagagaaaaaatgaagtaatatttcataaaatggataagacgaataaaaatgttcaaatg
attaaacataatattataactagccaaagaagagaaaatgggatggaacaatatactgct
atagatggtaaaaccaaagtaaacaacaacaataataatgataatagtaataacaataat
gataatagtaataacaataaaaataataataatgatatgaaagcaaatattcatcaagat
atggataaagtaaaaaataatatgatcgatttagaactatcagaattatggactaaaaaa
tcattaattgttaattttcaaaataatatatgtgaaataattttaaataggcccgaaaaa
ttaaatgcaataaataaggatatgataaatgcattattaaatataataaaaagtttagat
aatgatgaaagatgttttatggtaataattcgaagtactaacagcaactgtttttcatca
ggctcagatgtaaaatatgttgttgaaaataaagaacaaggtatacaacatttaaaacag
ctatatttgtatattaattatatatcccaaatgaaaaaaaatttactatgtatatggaat
ggatatgttatgggaggtggtctaggaatttctatt

DBGET integrated database retrieval system