KEGG   Plasmodium falciparum Dd2: PFDG_00980Help
Entry
PFDG_00980        CDS       T01051                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFDG_00980
Enzymes [BR:pfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PFDG_00980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 370 aa AA seqDB search
MNYMKQAREFLPEYLCIHDKSVYEELKELVKNIKDYKPIILCGDEGMKEICSSNSIDKIV
IGIDSFQGLYSTMYAIMNNKIVALANKESIVSAGFFLKKLLNIHKNAKIIPVDSEHSAIF
QCLDNNKVLKTKCLQDNFSKINNINKIFLCSSGGPFQNLTMDELKNVTSENALKHPKWKM
GKKITIDSATMMNKGLEVIETHFLFDVDYNDIEVIVHKECIIHSCVEFIDKSVISQMYYP
DMQIPILYSLTWPDRIKTNLKPLDLAQVSTLTFHKPSLEHFPCIKLAYQAGIKGNFYPTV
LNASNEIANNLFLNNKIKYFDISSIISQVLESFNSQKVSENSEDLMKQILQIHSWAKDKA
TDIYNKHNSS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatgaaacaagctagagaatttttaccagaatatttgtgtatacatgataaa
agtgtatatgaagaattaaaagaattggtaaaaaatataaaagattataaacctataata
ttgtgtggtgatgaagggatgaaagaaatatgtagtagtaatagtatagataaaatagtt
attggtattgattcttttcaaggattatattctactatgtatgcaattatgaataataaa
atagttgcgttagctaataaagaatccattgtctctgctggtttctttttaaagaaatta
ttaaatattcataaaaatgcaaagataatacctgttgattcagaacatagtgctatattt
caatgtttagataataataaggtattaaaaacaaaatgtttacaagacaatttttctaaa
attaacaatataaataaaatatttttatgttcatctggaggtccatttcaaaatttaact
atggacgaattaaaaaatgtaacatcagaaaatgctttaaagcatcctaaatggaaaatg
ggtaagaaaataactatagattctgcaactatgatgaataaaggtttagaggttatagaa
acccattttttatttgatgtagattataatgatatagaagttatagtacataaagaatgc
attatacattcttgtgttgaatttatagacaaatcagtaataagtcaaatgtattatcca
gatatgcaaatacccatattatattctttaacatggcctgatagaataaaaacaaattta
aaacctttagatttggctcaggtttcaactcttacatttcataaaccttctttagaacat
ttcccgtgtattaaattagcttatcaagcaggtataaaaggaaacttttatccaactgta
ctaaatgcgtcaaatgaaatagctaacaacttatttttgaataataaaattaaatatttt
gatatttcctctataatatcgcaagttcttgaatctttcaattctcaaaaggtttcggaa
aatagtgaagatttaatgaagcaaattctacaaatacattcttgggccaaagataaagct
accgatatatacaacaaacataattcttcatag

DBGET integrated database retrieval system