KEGG   Plasmodium falciparum Dd2: PFDG_01197Help
Entry
PFDG_01197        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pfd  Plasmodium falciparum Dd2
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PFDG_01197
Translation factors [BR:pfd03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PFDG_01197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 716 aa AA seqDB search
MVRVSDNELSDKELVDFLSEDSDNGDENLLNKKYSDKEALITLEVDFPKIVTILGIPKVE
SEKHGRLAEVLKKLFIRHLSAKISDSSLLNMKIHMPTDEENKTKGICFVTFNDSFQANEA
VKILNKLKLDAKHILTTSKMDDIENIINRDEKAMPINVVGFTREKIRWWLYDEKCREQFI
VRYDSHFEVHWFDPLEKEPQLIYTTFKKNAPFSSVQWSNQGSYLVSFHNPGIALWGGDSF
EKLIRLQHKSVKEIMFSPNENYVLTWDGTPYSLRNEKSICIWRVITGKLLRSFITPEYSP
KEKMFPHFLWSPDDKYIACIGKQKEVYVYELPSMLLIEDQEKKRTPLKYSGVKEFDWSPV
DNILAIWIPQTNDTPGTLILVDVPSRKELVSRKIYDVSVASIHWHNKGDYLCLKTTIQKK
SGKKIKKEYTQLEIFRMREKNIPVDNVQIEAVKTKQFHWEESNSNRFALILREETTNKQQ
IRFYKISNKGTARDAKWSSTFDINNQMNFMKWSPQGTYFILASLASEGTLYFCCLNNNDE
VDVIHKDEHLLVNSISWSRCGRFLVSAVSNNPNAFNTGYREENSEAGFHIWTFQGKCLMR
IKKPSFIQFLFRPHPKSLFNDKLKLDIKNNLNNYSKKFDNIDEKMKTAKKNALLTERKNV
ENSFNQKFQEITALFQSYQEYEQLKKNWETFENQFEWEEKTIVIEHVLSVKEEIFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggtacgagttagcgataacgaattgagtgataaggagttggtagattttttatcagaa
gatagtgataatggtgatgagaatttattaaataaaaaatattctgataaagaagcatta
ataactttagaagtagattttcctaagattgtaactatattaggtataccaaaagttgaa
tcagagaaacatgggaggttagctgaagtattgaagaaattatttataagacatttaagt
gctaagattagtgattcttctttattaaatatgaaaattcatatgcctactgatgaagag
aataaaaccaaaggtatatgttttgtaacgtttaatgatagttttcaagcaaatgaagct
gtgaagattttaaataaattaaaattagatgctaaacatatattaactacttcaaaaatg
gatgatatagaaaatattattaatagagatgagaaagctatgcctattaatgttgttggt
tttactcgagaaaaaattagatggtggctatatgatgaaaaatgtagagaacaatttatt
gttagatatgatagtcattttgaagtccattggtttgatcctttagaaaaagaaccgcaa
ttaatatatacgacttttaaaaaaaacgcacctttttcaagtgttcaatggagtaatcaa
ggttcttatttagttagctttcataatccagggatagctttatggggtggagatagtttt
gagaaattaattagattacaacataaaagcgttaaagaaatcatgttttctccgaacgaa
aattatgtattaacttgggatggtactccttattcattaaggaatgaaaaatctatttgt
atttggagagttatcacaggaaaattacttcgttcttttattactccagaatatagtcct
aaagaaaaaatgtttccacatttcttgtggagtccagatgataaatatattgcatgtata
ggaaaacaaaaagaagtctatgtgtatgaattaccatctatgttattaattgaagatcaa
gaaaaaaaaagaacacctctaaaatattcaggtgtaaaagaattcgattggtcacctgtc
gataatattctagctatatggattccacaaactaatgatacaccaggtacattaattctt
gttgatgtaccatctagaaaagaattagtttcaaggaaaatatatgatgtcagtgttgct
tctatacattggcataataaaggtgattatctatgtttaaaaacaaccattcaaaaaaaa
tcaggtaaaaaaatcaaaaaggaatatacacaactagaaatattccgtatgagagaaaaa
aacataccagtagataatgtacaaattgaagctgttaaaacaaaacaattccattgggaa
gaatcaaacagtaatcgttttgcacttatcctcagagaagaaacaactaataaacaacaa
atcagattctataaaatatccaataaaggaacagccagagatgctaaatggtccagtaca
tttgatatcaataatcaaatgaattttatgaaatggtcaccacaaggaacatattttata
ttagcatcattagcatcagaaggtacactctatttctgttgtttaaataataatgatgaa
gtagatgttatacataaagatgaacatctattagttaattctatatcctggagtcgttgt
ggaagattcctagtctcagctgtttccaataatccaaatgcttttaatactggttataga
gaagaaaatagtgaagcaggatttcatatatggacttttcaaggcaaatgtcttatgaga
attaaaaaaccatcatttattcaattcttatttagaccacatccaaagtcattatttaat
gataaacttaaactagatattaaaaataatctaaataattattcgaaaaaattcgataat
atagatgaaaaaatgaaaacagcaaagaaaaatgcattactcacagaaagaaaaaatgta
gaaaattcattcaaccaaaaatttcaagaaattactgcactcttccaatcctatcaagag
tatgaacaacttaaaaaaaattgggaaacattcgagaaccaatttgagtgggaagaaaaa
acaatagtcatcgagcatgtactgtctgtaaaggaggaaatatttgcctaa

DBGET integrated database retrieval system