KEGG   Plasmodium falciparum Dd2: PFDG_01256Help
Entry
PFDG_01256        CDS       T01051                                 

Definition
hypothetical protein similar to glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PFDG_01256
Enzymes [BR:pfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PFDG_01256
Exosome [BR:pfd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFDG_01256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 321 aa AA seqDB search
MNSKNVSYYINSNGKTKWLKPGWYDMIHRDYDQLIYFNDERNKVETVIIWDRITGKPLYN
AIVWLDTRVEELVTEFSAKYNNNDIQKKTGTYFNTYFSAFKILWLIQNNPEIKQKIDDGT
AVIGNINTWLIFNLTKGNCYTDVTNASRTLLMDINTLQWDEKMCKIFNITNMSVLPEIKS
NCSNFGLVKSEHVPDYLNIPITGCIGDQQSACIGQAIFDEGEAKCTYGTGVFLLINTGEK
VVYSTCGLITTICYKFNDNDKPKYALEGSIGTAGSGVSWLLKNKLIDDPSEASDIMEKCE
NTTGVIFVPAQRWIICTQMEM
NT seq 1897 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaaaaatgtgtcttattatataaatagtaacggcaaggtagaaaaaaatcct
ttctatatatacaaaataacgatcaacaaaaaaaaaattttcttttaaatatttttgtaa
aatatatatatatatgttttttgttatcttcttttaattttgcaatcggtgttttattgt
acatcctatattatacacatcaatcatacatgctacaaatgtataatatatatatatata
tacagatttttttcccaaatccatattaacaaaatttttaattttttttttttttttata
tgaatggaagcatatatataatatggttactataaaattaaaaatatatatatgtgtgta
catttttgtatttattaatgtctcaaataattttttataacaattgtattttaatttgaa
aaacgaattgtaacatgcgttgcaagttataaaaaaatttcacttttaaaatataaataa
gaaaaatataatatatatatttttattacttataccttataaaatacatgtttatataaa
taagtatatattttttgtatataagtatgtataggaatatatatatttatacatgtatat
atttttaaatatatgtacagataaatatctgtaaatatatatatgtataaatatattttt
ataaaattttcacgttatatataggcaaattaattgctgtcgaatattttaacaattttt
ttttttttgtgtatgctaaaatgttttcttattaaacaataatatatttatattagtttt
ttttttttttnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntggtcattcg
aatatatttaaatctagacaaaatggttgaaacctggttggtatgacatgatccatagag
attatgaccaacttatatactttaatgatgaacgcaataaagtgttaaaagataaataaa
catctgttataataaaaatgtaataggtattactacccaaagagaaactgtaattatatg
ggatagaataacaggaaaacctttatacaatgctatagtttggctagatacacgtgtaga
agaacttgttacggaattttctgcgaaatataataataatgatattcagaaaaaaacagg
aacttactttaatacatattttagtgcttttaaaatattgtggttaattcaaaacaatcc
agaaatcaaacaaaaaattgatgatggtactgcagttataggaaatattaatacatggct
tatttttaatttaactaaagggaattgttatacagatgttaccaatgcttcaagaacttt
attaatggatattaatacattacaatgggatgaaaagatgtgtaaaatatttaatattac
taatatgtctgttttacctgaaataaaaagtaattgttctaattttggtttagttaagtc
agaacatgttccggactatttaaatattcctattactggatgtattggagatcaacaaag
tgcatgcattggtcaagctatcttcgacgaaggtgaagcgaaatgtacatatggtacagg
tgtattccttctaattaatacaggagaaaaagttgtatattccacatgcggtttaattac
tactatatgttataaatttaatgataatgataaacctaaatatgctcttgaaggttcgat
aggtactgccggatctggagtttcatggcttcttaaaaacaaactaattgatgatccaag
tgaagctagcgatattatggaaaaatgtgaaaatacaactggagtcatttttgtaccagc
tcaacggtggattatatgcacccagatggagatgtga

DBGET integrated database retrieval system