KEGG   Plasmodium falciparum Dd2: PFDG_01372Help
Entry
PFDG_01372        CDS       T01051                                 

Definition
hypothetical protein similar to ubiquitin carboxyl-terminal hydrolase isozyme l5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pfd  Plasmodium falciparum Dd2
Brite
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFDG_01372
Peptidases [BR:pfd01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PFDG_01372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 465 aa AA seqDB search
MARDNENILEEWCLIESNPCIFYDMLKRMGATEISVEDVYSLSYFDDYINNKEIINMNHI
LGVDTYLGENNKTLDKENNVVDVIELYKNNICMEDKYNKLLKHHSYIYGIIFLFNIGKHY
KNNKYIEHNVPDNLFFAKQVIPNACATQAILSIVLNKDIELNDEIKNIKTFSLNFDSSMK
GLTLSNCTFLRNIHNSYKPPIYLDKEDVHHDKKKSEDSFHFVSYISFQDKVYLLDGLQSG
PVLINADEQNKPNPNNNNNNKDNDNDNNNNNNNNNNNNNNNNNNNNNNNNNNIGMNGKDW
IEISREHIKKEIDEICNSQTNNDVRFNIIAVMKDKEYIIQEYINIHRIVKQRVNIKLINL
GENIELSDEINEDEFPLLNDIPSIENLPNNVDTLYNIVNKSTLEINYLQSLLHEQKEIKK
LWNKELTFKFFNFYPFIMSSLNLMAKHKLLKDAYQKEKLKNATKS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgagggataatgaaaacattttagaagagtggtgtttaatagaaagtaacccgtgt
atattttatgatatgcttaaacgtatgggtgctacagaaatttcagtagaagatgtgtat
agtttatcttattttgatgattatataaataataaggagattataaatatgaatcatata
ttgggtgttgatacatatttaggagaaaataataaaacgctggataaagagaataatgtt
gttgatgttatcgaattatataagaataatatatgtatggaagataaatataataaatta
ttaaaacatcatagttatatttatggtataatatttttatttaatattggaaagcattat
aaaaataataaatatattgagcataatgttcctgataatttattttttgctaaacaagtt
ataccaaatgcatgtgctacacaagctattttgtctattgtgttgaataaggatatagaa
ttaaatgatgaaataaaaaatataaaaacatttagtttaaatttcgatagttcaatgaaa
ggattaacattatcaaattgtacttttcttcgtaatatacataattcatataaacctcca
atatatttagataaagaggatgtacatcatgataaaaaaaaaagtgaagactcctttcat
tttgtttcctatattagttttcaggataaagtatatttattggatggtttacaaagtggc
cccgtgcttataaatgcagacgagcaaaataaacccaacccaaacaataacaacaataat
aaggataatgataatgataataataacaacaataacaataataataacaataacaacaat
aacaacaataacaacaataacaataataataacaatattgggatgaatggaaaagattgg
atagaaatttctagagaacatataaaaaaagaaatagatgaaatatgtaattcacaaact
aataatgatgttcgttttaacattattgccgttatgaaagataaagaatacattattcaa
gaatatataaatatacatcgcatagttaaacaaagagttaatatcaaattaattaacctt
ggagaaaatattgaactatcagatgaaattaatgaagacgaatttcccttattaaacgat
ataccctcaatagaaaacctaccaaacaatgtagatactttatataatatagtaaataaa
tcaaccttagaaattaactatttacaatcattattacatgagcaaaaagaaataaaaaaa
ttatggaataaagaactgacttttaaattttttaatttctatcctttcataatgtcttct
cttaatttaatggctaagcataagttattaaaagatgcttatcaaaaagaaaaattaaaa
aatgcaacaaaatcttga

DBGET integrated database retrieval system