KEGG   Plasmodium falciparum Dd2: PFDG_01602Help
Entry
PFDG_01602        CDS       T01051                                 

Definition
thioredoxin
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pfd04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 423 aa AA seqDB search
MKVYNFSFICISLIFVFIKRSLGLYTNVAEIETVDNPKRLEELLNLKKVYLVQFYATWCR
VSRGFSNDFINIAKTLKDDVKFIAIKNESILNEYKITEYPTMHLIFGNEHNNKKEVEKFD
GKYKIKDVVSFIYEGIKNYRLKELNIDTSKKSSYKKKSKGKNDGKVIILNDSNFDQNVIQ
YDDNVWFVFFYAPWCGHSKPIHPMFDELAKKVAHLKNAKIAKIDATVEQRTAQTYQINHY
PSFRLFPSGNKKPHTAIDYNDSRTVDDLYHFFLKYYVEKKELIQLTSQQVFDEFCEKDVC
LLALLPNKEDTEPSYFKSYVHILSNVIKDVNHLPVTLLWTQAGDQLDIVQKLNLTFGFPT
VIALSLSKNVFSILKGNYSEQSIKNFITQMMMGKSSVDNLVPFKVKNVPKFSFNASNDIN
TEL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtataatttttcattcatatgtataagtttaattttcgttttcattaaacgt
agcttgggattatatacaaatgtagcagagatcgaaacagttgataaccctaaacggtta
gaagaattattaaatttaaaaaaagtgtatcttgttcagttttatgccacatggtgtagg
gtttcacgaggtttttctaacgacttcatcaatatagcaaaaacattaaaagatgatgtt
aaatttatagctataaaaaatgaaagtatattaaatgaatacaagattactgaatatcca
acaatgcatttaatttttggaaatgaacataataataaaaaagaagtagaaaaatttgat
ggaaaatataaaatcaaagatgtagtttcttttatatatgaaggtattaaaaattatcgt
ttaaaagaattgaatatagatacatccaaaaaaagttcatacaaaaaaaaatctaaaggt
aaaaatgacggaaaagtaatcattttaaatgatagtaattttgatcaaaatgttatacaa
tatgatgataatgtatggtttgtctttttctatgctccatggtgtggtcatagtaaacct
atacatccaatgtttgatgagctagccaaaaaagtagctcatttgaaaaatgctaaaata
gctaaaattgatgctacagtagaacaaagaacagcacaaacgtatcaaataaatcattat
ccatcttttagattatttccatcgggaaataaaaaacctcatactgcaattgattataat
gattcaagaactgttgatgatttatatcatttctttctaaaatattatgttgaaaaaaaa
gaattaattcaattaacatcacaacaagtttttgatgaattctgtgaaaaggatgtatgt
cttttagctctcttaccaaataaagaagatacagaaccttcatattttaaatcgtacgtt
catatattaagtaatgttattaaagacgtaaaccatttaccagttacattattatggaca
caagcaggtgatcaattggatattgttcaaaaattaaatttaacatttggtttcccaaca
gtaattgcattaagtctttcaaaaaatgttttttctatacttaaaggtaattattctgaa
caatccataaaaaattttattacacaaatgatgatgggcaaatcatccgtagataattta
gtaccatttaaagtaaaaaatgttccaaagttttcttttaacgcttctaatgatataaat
accgaattgtaa

DBGET integrated database retrieval system