KEGG   Plasmodium falciparum Dd2: PFDG_01632Help
Entry
PFDG_01632        CDS       T01051                                 

Definition
4-diphosphocytidyl-2c-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pfd00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
AA seq 460 aa AA seqDB search
MNQFLNLKCVLFYFFCTHLFFLHVITKHNLKKEKGYIIRNDYKCKRKRKNNNLKKRSFFI
ICKNCRPNNNKFYIINNKGGENIYNVKKKKACGYVRLNNEANVEKNNVVNTNKEIEKLLL
DVLDNRNNWYDSKYFSPAKINLFLRLKEKKETYNEVSTLMHSLNLGDDIFIRALKKEDQN
KLRHFLHPCESGDFLTIVRMEDKNRDKETLKEDCKIDVINKSDKDLFKHMKEDIIIQEHE
KLPYEYNDYPINNDNIIIKVLKRYREEFNISDDIRFLIHVNKRIPIFSGVGGGSSNGATV
FYFLENIFYKYFKGDNIKANEFLKTIGSDISFFSSSGFAYCTDKGNNVTDLKNIEANIKD
KDIYLFKIDEGLSSKLVYKNVDYKRIIQYNPVNLLKCLINTSNDDIIKQIEEKEKKFANT
FISLDNRDNLQNVFVNDLEHSAFYLIKSYRFKRYLRSQIC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagttcttaaacctaaaatgtgttttattttattttttttgtacgcatttattt
tttctccatgtaataactaagcataatttaaagaaagaaaaaggatatataataaggaat
gattataaatgtaaaaggaaaaggaaaaataataatttaaaaaagcgatctttttttata
atatgtaaaaactgtagaccaaataataacaaattttatattattaataataaaggaggt
gaaaatatatataatgttaaaaaaaagaaagcatgtggatatgtacgtttaaataatgag
gctaatgttgaaaagaataatgttgtaaatactaataaagaaatagagaaattattatta
gatgtattagataatcgtaataattggtacgattcaaaatatttctctcctgcaaaaatt
aatttatttttaagattgaaggaaaaaaaagaaacatataatgaagtatcaaccttaatg
cattcattaaatttgggtgatgatatttttataagagctttgaaaaaagaagatcaaaat
aaattaaggcattttttacatccatgtgaatctggagattttttgacaatagtaagaatg
gaagataaaaatagagataaggaaacattaaaagaagattgtaaaatagatgttattaat
aagagtgataaagatttatttaaacatatgaaagaagatataataattcaagaacatgaa
aaattaccatatgaatataatgattaccctataaataatgataatattattattaaggtt
ttaaaaagatatagagaagaatttaatataagtgacgatataagatttctaatacatgta
aataaaagaatacctatatttagtggtgttggtggtggctcatctaatggtgctactgtt
ttttatttcttagaaaatattttttataaatattttaaaggtgataatataaaagcaaat
gagtttttaaaaactataggaagcgatatatccttttttagtagttctggatttgcttat
tgtacggataaaggtaataatgtaacagatttaaaaaacatcgaagcaaatataaaagac
aaagatatatatttatttaaaattgatgaaggtttatcatcaaaattagtatataaaaat
gtagattataagcgaataatacaatataatccagtgaatttattaaaatgtttaattaat
acatcaaatgatgatataattaaacaaattgaagaaaaagaaaaaaaatttgccaacact
tttatttcgttagataacagagataatttacaaaatgtatttgttaatgatttagagcac
tcagcattttatttaattaaaagttacagatttaaaagatatttaagaagtcaaatatgt
tga

DBGET integrated database retrieval system