KEGG   Plasmodium falciparum Dd2: PFDG_01714Help
Entry
PFDG_01714        CDS       T01051                                 

Definition
predicted protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFDG_01714
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PFDG_01714
BRITE hierarchy
SSDB OrthologParalogGFIT
AA seq 191 aa AA seqDB search
MPYSLRRLRELIKKTKPKGLLFLSGDVHFGSIIGKEESVIEVTSSSVNQENIFSYINKYV
IFFLTNILSKVSPFELNKIYSFNNFGSVNITYVNDNEIKIKTSVNDSDGVEILVANQVFN
NKNNIYTKTKDLHIILDEFATLECKSKTKVVMHTIVYILFLLWFLQIIYIFLKVIGSLFR
RKKIDTKTKDE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgccttactctttgagacgtttaagggaactaataaaaaaaacgaaaccaaaaggttta
ttatttttaagtggggatgttcacttcggtagtataataggaaaggaagaaagtgtaata
gaggttacaagtagtagcgtaaatcaggagaacatttttagttatataaataaatatgtt
atattttttctaacaaatatattaagtaaggtaagtccatttgagttgaataaaatatat
tcatttaataatttcggttcagttaatattacatatgtgaatgataatgaaataaaaatt
aagacatctgtaaatgattcagatggtgtagaaatcttagtagctaatcaagtttttaat
aataaaaataatatatatactaaaacaaaagatttacatattattcttgatgaatttgca
acattagaatgcaagagtaaaacaaaggtcgtaatgcatacaatagtatatatattattt
ttattatggttcttacaaattatatatatatttctaaaagtaattggatcacttttccgc
aggaaaaaaatcgacacaaaaacaaaggatgaataa

DBGET integrated database retrieval system