KEGG   Plasmodium falciparum Dd2: PFDG_01919Help
Entry
PFDG_01919        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pfd  Plasmodium falciparum Dd2
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pfd03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 226 aa AA seqDB search
MKYLTFNKNNRDAIDLSEKLEATKIDLSNPLLLQYNWVIWEQVSDNKIKQSNNYKDYTRP
LAKFNSVQKFWQLWNRLPQPSDLLAQRSMTRFSEDGIFRIVDALMIFRDNIQPMWEDPAN
SGGGHFEYKILPKDYPYSQIDEFWNNLVLAIIGCSLKHYDLITGIRLVDKLSTTRYGYIR
IEIWYTTITDESVKNYLRKDLEEHMCNRIDGSTIFHQSKRPSHLPR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttaacatttaataaaaataacagagatgctattgatttgagtgaaaaacta
gaagctactaaaatagatttatcgaatcccttattattacaatataattgggtgatatgg
gaacaagtatcagataataaaataaaacaaagtaataattataaggattatacaagacca
ctagctaaatttaatagtgttcaaaaattttggcaattatggaatagattacctcaacca
agtgatttactggcacaaagaagtatgaccagattttcagaagatggaatatttcgtatt
gttgatgctcttatgatatttagagataatatacaacctatgtgggaagatccagcaaat
tcaggcggtgggccattttgaatataaaatattacctaaggattatccatatagccaaat
tgatgaattttggaataatctcgttttagctataattggatgtagtttaaaacattatga
tttaataacaggtattagattagtagataaattaagtactaccagatatggatatataag
aatagaaatatggtatactactatcactgatgaaagtgttaaaaactatttgagaaagat
ctagaagaacatatgtgtaatcgtatcgatggatcgactatattccaccagagtaaaagg
cctagtcacctacctagataa

DBGET integrated database retrieval system