KEGG   Plasmodium falciparum Dd2: PFDG_01919Help
Entry
PFDG_01919        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pfd  Plasmodium falciparum Dd2
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PFDG_01919
Translation factors [BR:pfd03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PFDG_01919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 226 aa AA seqDB search
MKYLTFNKNNRDAIDLSEKLEATKIDLSNPLLLQYNWVIWEQVSDNKIKQSNNYKDYTRP
LAKFNSVQKFWQLWNRLPQPSDLLAQRSMTRFSEDGIFRIVDALMIFRDNIQPMWEDPAN
SGGGHFEYKILPKDYPYSQIDEFWNNLVLAIIGCSLKHYDLITGIRLVDKLSTTRYGYIR
IEIWYTTITDESVKNYLRKDLEEHMCNRIDGSTIFHQSKRPSHLPR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttaacatttaataaaaataacagagatgctattgatttgagtgaaaaacta
gaagctactaaaatagatttatcgaatcccttattattacaatataattgggtgatatgg
gaacaagtatcagataataaaataaaacaaagtaataattataaggattatacaagacca
ctagctaaatttaatagtgttcaaaaattttggcaattatggaatagattacctcaacca
agtgatttactggcacaaagaagtatgaccagattttcagaagatggaatatttcgtatt
gttgatgctcttatgatatttagagataatatacaacctatgtgggaagatccagcaaat
tcaggcggtgggccattttgaatataaaatattacctaaggattatccatatagccaaat
tgatgaattttggaataatctcgttttagctataattggatgtagtttaaaacattatga
tttaataacaggtattagattagtagataaattaagtactaccagatatggatatataag
aatagaaatatggtatactactatcactgatgaaagtgttaaaaactatttgagaaagat
ctagaagaacatatgtgtaatcgtatcgatggatcgactatattccaccagagtaaaagg
cctagtcacctacctagataa

DBGET integrated database retrieval system